Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y1K3

Protein Details
Accession A0A6A6Y1K3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
299-319SILPGVKKRKRSETPPERMASHydrophilic
NLS Segment(s)
PositionSequence
293-310RALARHSILPGVKKRKRS
Subcellular Location(s) nucl 15.5, cyto_nucl 14.5, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MSSSQTPLKELITPPSSLIDAPLTPPPTNEKAFTQVPRVIALFKDIQAGRHTKQHPWIEFQLARGEYDEIERQLRRDEPLFGYVKDKIRYDYYGGSHRLVVRMPTGVHELFIDGVEDAIRSQLKAIRSGSDRAALFAQKVRPARSTEISFPHDDAQYPGVIIEVAYSQKKRLSRLVEDYLLDSDASVQVVVGLDIEYGKEGSRKATLLVWRAQIAHTTNGDELRVVREIADEAFRDDQGHPTNHPGLRLQLSDFACEELTQDAIRGEDREITVSSLELCQYIAVAEDKIRRQRALARHSILPGVKKRKRSETPPERMASDDEAKFAKQEERAAKRMADYDPDYEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.23
5 0.23
6 0.17
7 0.15
8 0.17
9 0.22
10 0.24
11 0.23
12 0.24
13 0.29
14 0.32
15 0.34
16 0.34
17 0.31
18 0.34
19 0.4
20 0.42
21 0.41
22 0.39
23 0.37
24 0.37
25 0.35
26 0.3
27 0.24
28 0.26
29 0.22
30 0.19
31 0.25
32 0.23
33 0.24
34 0.28
35 0.34
36 0.31
37 0.38
38 0.4
39 0.38
40 0.47
41 0.54
42 0.51
43 0.53
44 0.54
45 0.53
46 0.52
47 0.48
48 0.46
49 0.38
50 0.35
51 0.29
52 0.26
53 0.18
54 0.21
55 0.22
56 0.17
57 0.21
58 0.21
59 0.21
60 0.24
61 0.25
62 0.26
63 0.25
64 0.27
65 0.25
66 0.31
67 0.33
68 0.3
69 0.31
70 0.33
71 0.37
72 0.35
73 0.33
74 0.3
75 0.31
76 0.32
77 0.32
78 0.31
79 0.29
80 0.33
81 0.34
82 0.33
83 0.32
84 0.31
85 0.29
86 0.24
87 0.22
88 0.16
89 0.16
90 0.15
91 0.14
92 0.18
93 0.16
94 0.15
95 0.14
96 0.13
97 0.11
98 0.11
99 0.1
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.06
106 0.06
107 0.05
108 0.07
109 0.1
110 0.11
111 0.16
112 0.16
113 0.19
114 0.22
115 0.24
116 0.24
117 0.26
118 0.24
119 0.22
120 0.22
121 0.18
122 0.17
123 0.18
124 0.19
125 0.19
126 0.22
127 0.23
128 0.24
129 0.27
130 0.3
131 0.31
132 0.32
133 0.3
134 0.33
135 0.34
136 0.32
137 0.3
138 0.28
139 0.24
140 0.21
141 0.19
142 0.14
143 0.11
144 0.1
145 0.09
146 0.06
147 0.06
148 0.05
149 0.04
150 0.04
151 0.05
152 0.07
153 0.08
154 0.09
155 0.12
156 0.14
157 0.17
158 0.22
159 0.25
160 0.28
161 0.34
162 0.37
163 0.36
164 0.34
165 0.33
166 0.27
167 0.22
168 0.17
169 0.11
170 0.07
171 0.06
172 0.05
173 0.04
174 0.03
175 0.03
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.04
185 0.04
186 0.05
187 0.06
188 0.07
189 0.09
190 0.09
191 0.1
192 0.14
193 0.17
194 0.2
195 0.23
196 0.23
197 0.22
198 0.23
199 0.22
200 0.21
201 0.19
202 0.18
203 0.16
204 0.16
205 0.16
206 0.16
207 0.16
208 0.13
209 0.12
210 0.11
211 0.11
212 0.1
213 0.09
214 0.09
215 0.09
216 0.1
217 0.11
218 0.09
219 0.11
220 0.12
221 0.12
222 0.13
223 0.13
224 0.17
225 0.2
226 0.21
227 0.2
228 0.24
229 0.3
230 0.29
231 0.29
232 0.26
233 0.25
234 0.26
235 0.26
236 0.22
237 0.23
238 0.23
239 0.23
240 0.23
241 0.2
242 0.17
243 0.16
244 0.16
245 0.09
246 0.1
247 0.08
248 0.08
249 0.07
250 0.08
251 0.09
252 0.09
253 0.09
254 0.12
255 0.12
256 0.14
257 0.14
258 0.14
259 0.14
260 0.13
261 0.13
262 0.11
263 0.11
264 0.09
265 0.08
266 0.07
267 0.07
268 0.06
269 0.07
270 0.07
271 0.08
272 0.11
273 0.17
274 0.23
275 0.31
276 0.34
277 0.33
278 0.35
279 0.43
280 0.48
281 0.52
282 0.55
283 0.52
284 0.52
285 0.53
286 0.56
287 0.5
288 0.49
289 0.5
290 0.51
291 0.53
292 0.58
293 0.64
294 0.69
295 0.75
296 0.77
297 0.79
298 0.79
299 0.83
300 0.82
301 0.78
302 0.69
303 0.63
304 0.56
305 0.51
306 0.47
307 0.38
308 0.32
309 0.31
310 0.29
311 0.28
312 0.27
313 0.26
314 0.22
315 0.3
316 0.37
317 0.43
318 0.47
319 0.5
320 0.49
321 0.47
322 0.49
323 0.43
324 0.4
325 0.37