Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YFV0

Protein Details
Accession A0A6A6YFV0    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
18-41QAPTPSVKPPQPPKPPKPAPIQAAHydrophilic
NLS Segment(s)
PositionSequence
189-241LTRKERLARLAEAKAKKPAGVDRKPAPNKHAAPGHDAVRAKAGPAGKEKPKPK
368-379LKRLKAERKRKG
Subcellular Location(s) nucl 20, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MSFLTSLLSDIDPSAAAQAPTPSVKPPQPPKPPKPAPIQAAPTNGIASTQPTKRKAEGDATPVPNKVQRRDAPNGTSGTVRPVQGVYGSKPKAPGAPDPLPYRGTATSTTNILNASKPQKRTPDPSSKPSTGTQSTYTGSGPAVKAAPRPVVPQAPPKAGSYAAILAKAKEAAANPAVLTIKHKPAEILTRKERLARLAEAKAKKPAGVDRKPAPNKHAAPGHDAVRAKAGPAGKEKPKPKAVDLGYQGTMRPKPTVESGYQGTMRGGPPPPHTRAGTGPAARKQSFDRSRSGSLAVKPKAAAQKGGRMAGRAYYSQSDLDDEEEDDYGSDESSDMEAGAWDVEEEERKALLTAKKEDEEELRRENELKRLKAERKRKGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.13
6 0.16
7 0.18
8 0.19
9 0.2
10 0.24
11 0.29
12 0.38
13 0.46
14 0.54
15 0.63
16 0.72
17 0.77
18 0.82
19 0.86
20 0.84
21 0.84
22 0.82
23 0.77
24 0.75
25 0.73
26 0.67
27 0.63
28 0.57
29 0.48
30 0.4
31 0.33
32 0.26
33 0.19
34 0.19
35 0.21
36 0.25
37 0.31
38 0.36
39 0.4
40 0.43
41 0.46
42 0.46
43 0.47
44 0.46
45 0.46
46 0.5
47 0.51
48 0.51
49 0.48
50 0.46
51 0.43
52 0.43
53 0.41
54 0.41
55 0.42
56 0.47
57 0.54
58 0.58
59 0.57
60 0.57
61 0.54
62 0.45
63 0.41
64 0.34
65 0.31
66 0.27
67 0.24
68 0.2
69 0.18
70 0.17
71 0.19
72 0.21
73 0.2
74 0.26
75 0.27
76 0.27
77 0.29
78 0.3
79 0.3
80 0.3
81 0.32
82 0.31
83 0.35
84 0.39
85 0.41
86 0.42
87 0.39
88 0.37
89 0.34
90 0.26
91 0.24
92 0.21
93 0.21
94 0.2
95 0.2
96 0.21
97 0.18
98 0.18
99 0.17
100 0.15
101 0.18
102 0.25
103 0.29
104 0.32
105 0.36
106 0.44
107 0.48
108 0.55
109 0.58
110 0.61
111 0.61
112 0.65
113 0.68
114 0.61
115 0.59
116 0.54
117 0.51
118 0.43
119 0.4
120 0.34
121 0.29
122 0.28
123 0.26
124 0.24
125 0.18
126 0.15
127 0.15
128 0.12
129 0.11
130 0.11
131 0.11
132 0.13
133 0.15
134 0.17
135 0.15
136 0.18
137 0.2
138 0.23
139 0.24
140 0.31
141 0.32
142 0.32
143 0.33
144 0.31
145 0.29
146 0.25
147 0.23
148 0.17
149 0.16
150 0.14
151 0.14
152 0.13
153 0.12
154 0.12
155 0.12
156 0.1
157 0.08
158 0.08
159 0.09
160 0.09
161 0.09
162 0.09
163 0.1
164 0.11
165 0.09
166 0.12
167 0.13
168 0.17
169 0.17
170 0.18
171 0.16
172 0.18
173 0.27
174 0.3
175 0.34
176 0.34
177 0.37
178 0.38
179 0.4
180 0.39
181 0.33
182 0.3
183 0.27
184 0.26
185 0.27
186 0.34
187 0.34
188 0.34
189 0.36
190 0.33
191 0.31
192 0.28
193 0.3
194 0.33
195 0.36
196 0.4
197 0.4
198 0.5
199 0.55
200 0.56
201 0.52
202 0.51
203 0.48
204 0.47
205 0.47
206 0.38
207 0.38
208 0.39
209 0.37
210 0.33
211 0.31
212 0.26
213 0.24
214 0.23
215 0.18
216 0.18
217 0.17
218 0.15
219 0.2
220 0.26
221 0.3
222 0.37
223 0.42
224 0.46
225 0.51
226 0.52
227 0.48
228 0.51
229 0.47
230 0.47
231 0.46
232 0.43
233 0.38
234 0.35
235 0.34
236 0.29
237 0.29
238 0.22
239 0.2
240 0.16
241 0.17
242 0.2
243 0.23
244 0.2
245 0.22
246 0.23
247 0.25
248 0.25
249 0.24
250 0.2
251 0.19
252 0.18
253 0.18
254 0.19
255 0.2
256 0.26
257 0.31
258 0.35
259 0.37
260 0.37
261 0.36
262 0.36
263 0.38
264 0.38
265 0.36
266 0.38
267 0.39
268 0.45
269 0.43
270 0.42
271 0.4
272 0.44
273 0.48
274 0.45
275 0.46
276 0.45
277 0.48
278 0.48
279 0.47
280 0.41
281 0.39
282 0.46
283 0.41
284 0.37
285 0.34
286 0.38
287 0.42
288 0.39
289 0.4
290 0.33
291 0.4
292 0.42
293 0.47
294 0.42
295 0.36
296 0.35
297 0.32
298 0.32
299 0.24
300 0.23
301 0.21
302 0.22
303 0.21
304 0.21
305 0.19
306 0.17
307 0.18
308 0.16
309 0.14
310 0.13
311 0.13
312 0.12
313 0.1
314 0.1
315 0.09
316 0.07
317 0.07
318 0.06
319 0.06
320 0.07
321 0.07
322 0.06
323 0.06
324 0.06
325 0.06
326 0.06
327 0.05
328 0.05
329 0.05
330 0.07
331 0.09
332 0.1
333 0.11
334 0.11
335 0.12
336 0.13
337 0.18
338 0.22
339 0.26
340 0.32
341 0.37
342 0.39
343 0.4
344 0.43
345 0.45
346 0.46
347 0.45
348 0.44
349 0.4
350 0.4
351 0.43
352 0.43
353 0.45
354 0.47
355 0.46
356 0.48
357 0.56
358 0.64
359 0.7
360 0.77
361 0.78