Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z269

Protein Details
Accession A0A6A6Z269    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-105SQSSIPPPIKPKPKRKPPPPPKKPAFLSHydrophilic
NLS Segment(s)
PositionSequence
85-101PIKPKPKRKPPPPPKKP
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MRPAYLICEKDEDLTKELVLDLFEEKDSMTTQLSSESGGQPTILTPDSTVEADPKSPEAPRSSPRPPSASPTTSPSQSQSSIPPPIKPKPKRKPPPPPKKPAFLSVGSTSSTSTSPTRSPIVPPKPQELGTSILEIGNLDIPITSTPSPTPSRPIITIRRLDPSKIAPSRFQQSDPVNWDAATPSPRRTASPKPSPTVRFAPSPRLTPSRSPAPRRDRYESQDSNGDADEEIQAAIAASLESFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.23
4 0.23
5 0.2
6 0.14
7 0.12
8 0.11
9 0.11
10 0.11
11 0.11
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.1
18 0.1
19 0.12
20 0.12
21 0.13
22 0.14
23 0.15
24 0.15
25 0.14
26 0.14
27 0.12
28 0.12
29 0.14
30 0.12
31 0.1
32 0.09
33 0.11
34 0.12
35 0.13
36 0.13
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.14
43 0.15
44 0.18
45 0.21
46 0.25
47 0.29
48 0.35
49 0.4
50 0.45
51 0.48
52 0.51
53 0.47
54 0.5
55 0.52
56 0.48
57 0.44
58 0.42
59 0.41
60 0.37
61 0.36
62 0.32
63 0.27
64 0.25
65 0.25
66 0.23
67 0.25
68 0.31
69 0.31
70 0.32
71 0.35
72 0.41
73 0.5
74 0.56
75 0.62
76 0.65
77 0.76
78 0.82
79 0.87
80 0.91
81 0.92
82 0.94
83 0.93
84 0.93
85 0.86
86 0.84
87 0.76
88 0.69
89 0.63
90 0.53
91 0.46
92 0.38
93 0.34
94 0.26
95 0.24
96 0.19
97 0.15
98 0.14
99 0.12
100 0.1
101 0.11
102 0.11
103 0.14
104 0.15
105 0.15
106 0.19
107 0.26
108 0.32
109 0.36
110 0.37
111 0.39
112 0.39
113 0.39
114 0.36
115 0.29
116 0.26
117 0.21
118 0.19
119 0.16
120 0.13
121 0.12
122 0.11
123 0.09
124 0.06
125 0.05
126 0.04
127 0.04
128 0.04
129 0.05
130 0.07
131 0.07
132 0.07
133 0.08
134 0.12
135 0.15
136 0.15
137 0.2
138 0.2
139 0.22
140 0.24
141 0.3
142 0.33
143 0.37
144 0.4
145 0.38
146 0.43
147 0.41
148 0.4
149 0.37
150 0.34
151 0.37
152 0.37
153 0.38
154 0.34
155 0.37
156 0.43
157 0.42
158 0.39
159 0.37
160 0.35
161 0.39
162 0.4
163 0.38
164 0.32
165 0.3
166 0.28
167 0.22
168 0.22
169 0.21
170 0.18
171 0.19
172 0.23
173 0.24
174 0.27
175 0.32
176 0.4
177 0.45
178 0.54
179 0.57
180 0.57
181 0.64
182 0.65
183 0.65
184 0.61
185 0.55
186 0.52
187 0.49
188 0.53
189 0.49
190 0.5
191 0.49
192 0.48
193 0.49
194 0.47
195 0.5
196 0.51
197 0.57
198 0.6
199 0.64
200 0.69
201 0.75
202 0.77
203 0.79
204 0.76
205 0.75
206 0.78
207 0.72
208 0.67
209 0.64
210 0.56
211 0.5
212 0.42
213 0.35
214 0.25
215 0.21
216 0.17
217 0.11
218 0.1
219 0.07
220 0.07
221 0.06
222 0.06
223 0.05
224 0.04