Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y550

Protein Details
Accession A0A6A6Y550    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-151ADAPETRKGKRDRKRRSPEEAGAABasic
NLS Segment(s)
PositionSequence
102-148AARAAKEQAKAEGKGKRGRKRKSPVEADAPETRKGKRDRKRRSPEEA
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPKPPPTINISKADAAKVGPCPQDQDAYVLDETSKQSLQRHLHKFVKAAQTSFAKGVLQQDHIRFLSRINDEAKVRRSTKSEILAKGVGKVMSYEDLEAARAARAAKEQAKAEGKGKRGRKRKSPVEADAPETRKGKRDRKRRSPEEAGAAEPKAKVAQMSEVSEPARAPMARMSEAQVEEDETAPKPWRAPVARMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.3
3 0.28
4 0.27
5 0.29
6 0.27
7 0.26
8 0.29
9 0.3
10 0.32
11 0.29
12 0.28
13 0.23
14 0.23
15 0.23
16 0.18
17 0.17
18 0.16
19 0.17
20 0.16
21 0.17
22 0.15
23 0.18
24 0.26
25 0.34
26 0.42
27 0.47
28 0.53
29 0.58
30 0.58
31 0.58
32 0.57
33 0.59
34 0.51
35 0.45
36 0.41
37 0.38
38 0.37
39 0.35
40 0.28
41 0.19
42 0.18
43 0.22
44 0.19
45 0.21
46 0.23
47 0.23
48 0.26
49 0.27
50 0.27
51 0.22
52 0.21
53 0.24
54 0.21
55 0.24
56 0.21
57 0.25
58 0.25
59 0.3
60 0.34
61 0.33
62 0.33
63 0.33
64 0.34
65 0.35
66 0.38
67 0.41
68 0.42
69 0.37
70 0.38
71 0.38
72 0.35
73 0.32
74 0.28
75 0.2
76 0.14
77 0.13
78 0.1
79 0.09
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.05
88 0.06
89 0.06
90 0.05
91 0.06
92 0.1
93 0.13
94 0.16
95 0.16
96 0.2
97 0.24
98 0.25
99 0.29
100 0.3
101 0.32
102 0.36
103 0.45
104 0.49
105 0.55
106 0.61
107 0.66
108 0.71
109 0.76
110 0.79
111 0.78
112 0.74
113 0.74
114 0.69
115 0.64
116 0.61
117 0.54
118 0.49
119 0.43
120 0.38
121 0.37
122 0.44
123 0.49
124 0.51
125 0.59
126 0.66
127 0.75
128 0.85
129 0.86
130 0.87
131 0.85
132 0.81
133 0.79
134 0.69
135 0.61
136 0.53
137 0.45
138 0.37
139 0.28
140 0.23
141 0.15
142 0.14
143 0.11
144 0.09
145 0.15
146 0.17
147 0.2
148 0.2
149 0.22
150 0.23
151 0.23
152 0.22
153 0.17
154 0.18
155 0.15
156 0.15
157 0.17
158 0.2
159 0.21
160 0.23
161 0.25
162 0.25
163 0.26
164 0.26
165 0.22
166 0.2
167 0.19
168 0.19
169 0.18
170 0.14
171 0.17
172 0.19
173 0.2
174 0.2
175 0.22
176 0.31
177 0.33