Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y368

Protein Details
Accession A0A6A6Y368    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-105QIHKRGSSRRASKPCRDSRPCVRCSQRRVRCDRMIPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MNRYLSSAVGTHSGPAGSPRFYCSECSRGYSAIGKLNRYCKNHSSSNKHVCRFCQTGFKRKDLLDRHLQIHKRGSSRRASKPCRDSRPCVRCSQRRVRCDRMIPCSGCARGNHSCQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.16
4 0.15
5 0.16
6 0.18
7 0.2
8 0.22
9 0.27
10 0.27
11 0.3
12 0.3
13 0.33
14 0.32
15 0.29
16 0.3
17 0.3
18 0.27
19 0.29
20 0.29
21 0.28
22 0.31
23 0.38
24 0.43
25 0.43
26 0.46
27 0.44
28 0.47
29 0.53
30 0.58
31 0.58
32 0.61
33 0.67
34 0.69
35 0.68
36 0.64
37 0.57
38 0.55
39 0.5
40 0.42
41 0.41
42 0.38
43 0.44
44 0.45
45 0.46
46 0.43
47 0.4
48 0.46
49 0.41
50 0.43
51 0.42
52 0.42
53 0.43
54 0.46
55 0.47
56 0.43
57 0.44
58 0.43
59 0.4
60 0.41
61 0.43
62 0.46
63 0.52
64 0.59
65 0.63
66 0.66
67 0.69
68 0.76
69 0.8
70 0.81
71 0.8
72 0.78
73 0.79
74 0.8
75 0.74
76 0.73
77 0.74
78 0.71
79 0.74
80 0.78
81 0.76
82 0.76
83 0.81
84 0.81
85 0.79
86 0.8
87 0.78
88 0.75
89 0.74
90 0.67
91 0.62
92 0.59
93 0.52
94 0.47
95 0.41
96 0.4
97 0.38