Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YZ84

Protein Details
Accession A0A6A6YZ84    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-66NPKPISYRGGKKRKERELETNNRYHBasic
NLS Segment(s)
PositionSequence
43-56PKPISYRGGKKRKE
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MQQSFSPPDETLKPSLAVEPEHWMTRKKQIQPRRVVTSSRNNPKPISYRGGKKRKERELETNNRYHLAKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.23
4 0.2
5 0.18
6 0.2
7 0.2
8 0.22
9 0.23
10 0.23
11 0.24
12 0.32
13 0.37
14 0.41
15 0.48
16 0.54
17 0.62
18 0.69
19 0.73
20 0.72
21 0.67
22 0.61
23 0.58
24 0.59
25 0.59
26 0.6
27 0.58
28 0.52
29 0.51
30 0.53
31 0.53
32 0.47
33 0.44
34 0.4
35 0.46
36 0.54
37 0.63
38 0.66
39 0.71
40 0.76
41 0.79
42 0.83
43 0.8
44 0.8
45 0.81
46 0.84
47 0.82
48 0.78
49 0.71
50 0.65
51 0.59