Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Z7W8

Protein Details
Accession A0A6A6Z7W8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MIKPIPRKRKQLPVIQTNPPKKTRKNKKTENVLGEYYHydrophilic
NLS Segment(s)
PositionSequence
6-12PRKRKQL
18-28NPPKKTRKNKK
Subcellular Location(s) mito 19, cyto 5, nucl 2
Family & Domain DBs
Amino Acid Sequences MIKPIPRKRKQLPVIQTNPPKKTRKNKKTENVLGEYYTTSLQARLNTLPAHLIASLGRLRIVNGASAFNAETGRTIAARLPNLATVTFFTSHGGLLPLGFDKFMSHLSAQTMGSLVVRMTRPVRFRTTDANIEAWMEIIQDVHLGEGWEVRRDVEAELTGGTTLMVCRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.8
5 0.79
6 0.77
7 0.75
8 0.74
9 0.79
10 0.8
11 0.81
12 0.83
13 0.87
14 0.89
15 0.92
16 0.91
17 0.88
18 0.82
19 0.73
20 0.63
21 0.53
22 0.43
23 0.33
24 0.24
25 0.17
26 0.12
27 0.11
28 0.12
29 0.12
30 0.15
31 0.14
32 0.17
33 0.16
34 0.16
35 0.15
36 0.14
37 0.13
38 0.1
39 0.1
40 0.07
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.1
47 0.11
48 0.12
49 0.11
50 0.1
51 0.11
52 0.1
53 0.11
54 0.1
55 0.09
56 0.09
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.1
65 0.1
66 0.11
67 0.1
68 0.11
69 0.12
70 0.11
71 0.1
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.09
94 0.1
95 0.12
96 0.12
97 0.11
98 0.1
99 0.08
100 0.08
101 0.08
102 0.06
103 0.08
104 0.08
105 0.1
106 0.13
107 0.17
108 0.21
109 0.25
110 0.3
111 0.31
112 0.33
113 0.39
114 0.42
115 0.43
116 0.42
117 0.39
118 0.34
119 0.31
120 0.28
121 0.21
122 0.15
123 0.09
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.1
134 0.11
135 0.14
136 0.14
137 0.14
138 0.15
139 0.16
140 0.17
141 0.16
142 0.15
143 0.13
144 0.13
145 0.13
146 0.12
147 0.11
148 0.09
149 0.07
150 0.07