FuNGI

A0A6A6YK91

Protein Details

Accession

A0A6A6YK91

Localization Confidence

Medium

Confidence Score

11.2

NoLS Segment(s)

Position	Sequence	Protein Nature
83-106	HVKVVRRSSRAKWRRRSCWGCIAI	Hydrophilic

NLS Segment(s)

Position	Sequence
63-70	RRGNARRR
90-96	SSRAKWR

Subcellular Location(s)

plas 16, nucl 3, mito 3, mito_nucl 3

Family & Domain DBs

InterPro	View protein in InterPro IPR017946 PLC-like_Pdiesterase_TIM-brl
Gene Ontology	GO:0016020 C:membrane GO:0008081 F:phosphoric diester hydrolase activity GO:0006629 P:lipid metabolic process

Amino Acid Sequences

MAPHGHLGNAENSMTRDFEDFNTPLKDAPIISLRALENGNDLFHAKDSAISIWRRLLMTLRGRRGNARRRAPELDSPASPTVHVKVVRRSSRAKWRRRSCWGCIAIPVLALLFFGMVHVANVIMSLVPMIWDNAVDTDLFLPNWGKPNSPGEGLSSYPTDFTRDVRPIPCHSHNDYWRRVPLYLALHYGCTGVEADVWLFDDDLFVGHNTASLSLNRTFRNLYVNPLVEILDRANPSTAFTSADPSLTDTLNGVFDEDPTQNLVLLVDFKNAGDALWPVVSAQLSALREKNYLSWTDGSTVYPGPITVVATGNAPFDLLTSNTTYRDIFFDAPLAAMYEEPFSSDRPYHAHPPHDHDHNYDHSEATPPLPQLATPRRDSGQGETGLVPGSSFDTTNSYYASTNFRSAIGFVWGNRLSHRQIELIRGMVAGAKSRGLVARFWNTPAWPIGVRNHVWRVLVREGAGMLSVDDVEAAGRGNWGRRKHWGWL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.17
3	0.16
4	0.16
5	0.18
6	0.23
7	0.23
8	0.26
9	0.29
10	0.28
11	0.27
12	0.26
13	0.25
14	0.19
15	0.21
16	0.22
17	0.21
18	0.21
19	0.25
20	0.24
21	0.25
22	0.26
23	0.22
24	0.2
25	0.19
26	0.19
27	0.15
28	0.16
29	0.14
30	0.14
31	0.15
32	0.11
33	0.12
34	0.13
35	0.15
36	0.2
37	0.21
38	0.23
39	0.24
40	0.27
41	0.26
42	0.25
43	0.27
44	0.29
45	0.38
46	0.44
47	0.49
48	0.52
49	0.53
50	0.61
51	0.67
52	0.69
53	0.69
54	0.7
55	0.69
56	0.7
57	0.75
58	0.71
59	0.69
60	0.67
61	0.62
62	0.52
63	0.51
64	0.46
65	0.4
66	0.35
67	0.29
68	0.23
69	0.25
70	0.27
71	0.26
72	0.33
73	0.43
74	0.49
75	0.52
76	0.56
77	0.58
78	0.66
79	0.72
80	0.73
81	0.74
82	0.78
83	0.83
84	0.88
85	0.86
86	0.82
87	0.83
88	0.78
89	0.68
90	0.6
91	0.53
92	0.42
93	0.34
94	0.27
95	0.16
96	0.11
97	0.09
98	0.06
99	0.04
100	0.03
101	0.03
102	0.04
103	0.03
104	0.04
105	0.04
106	0.04
107	0.03
108	0.04
109	0.04
110	0.03
111	0.03
112	0.03
113	0.03
114	0.03
115	0.04
116	0.04
117	0.04
118	0.04
119	0.05
120	0.05
121	0.06
122	0.05
123	0.06
124	0.07
125	0.08
126	0.07
127	0.08
128	0.09
129	0.1
130	0.17
131	0.17
132	0.17
133	0.19
134	0.23
135	0.25
136	0.25
137	0.24
138	0.2
139	0.21
140	0.21
141	0.2
142	0.17
143	0.15
144	0.14
145	0.14
146	0.14
147	0.13
148	0.15
149	0.19
150	0.21
151	0.24
152	0.27
153	0.31
154	0.32
155	0.39
156	0.43
157	0.42
158	0.44
159	0.49
160	0.53
161	0.57
162	0.57
163	0.54
164	0.53
165	0.49
166	0.44
167	0.36
168	0.34
169	0.3
170	0.27
171	0.26
172	0.22
173	0.2
174	0.2
175	0.19
176	0.14
177	0.1
178	0.08
179	0.05
180	0.05
181	0.05
182	0.05
183	0.04
184	0.06
185	0.05
186	0.05
187	0.05
188	0.05
189	0.04
190	0.04
191	0.05
192	0.04
193	0.04
194	0.04
195	0.05
196	0.05
197	0.06
198	0.07
199	0.07
200	0.11
201	0.14
202	0.18
203	0.17
204	0.19
205	0.18
206	0.18
207	0.24
208	0.21
209	0.22
210	0.23
211	0.23
212	0.22
213	0.22
214	0.21
215	0.15
216	0.15
217	0.11
218	0.1
219	0.1
220	0.1
221	0.1
222	0.1
223	0.11
224	0.11
225	0.11
226	0.09
227	0.09
228	0.12
229	0.11
230	0.12
231	0.1
232	0.11
233	0.12
234	0.1
235	0.1
236	0.07
237	0.07
238	0.07
239	0.07
240	0.07
241	0.05
242	0.06
243	0.08
244	0.08
245	0.08
246	0.08
247	0.08
248	0.07
249	0.07
250	0.07
251	0.05
252	0.07
253	0.07
254	0.07
255	0.07
256	0.07
257	0.07
258	0.07
259	0.07
260	0.05
261	0.05
262	0.05
263	0.05
264	0.05
265	0.05
266	0.06
267	0.06
268	0.05
269	0.05
270	0.08
271	0.09
272	0.11
273	0.13
274	0.13
275	0.14
276	0.14
277	0.16
278	0.15
279	0.15
280	0.16
281	0.16
282	0.16
283	0.17
284	0.18
285	0.16
286	0.15
287	0.14
288	0.12
289	0.1
290	0.09
291	0.07
292	0.07
293	0.07
294	0.07
295	0.07
296	0.07
297	0.08
298	0.09
299	0.09
300	0.08
301	0.07
302	0.06
303	0.05
304	0.06
305	0.06
306	0.07
307	0.09
308	0.11
309	0.11
310	0.13
311	0.13
312	0.13
313	0.14
314	0.15
315	0.14
316	0.13
317	0.13
318	0.12
319	0.12
320	0.11
321	0.1
322	0.07
323	0.06
324	0.07
325	0.06
326	0.06
327	0.08
328	0.08
329	0.09
330	0.11
331	0.12
332	0.13
333	0.16
334	0.21
335	0.29
336	0.32
337	0.39
338	0.4
339	0.46
340	0.5
341	0.53
342	0.5
343	0.43
344	0.43
345	0.41
346	0.41
347	0.34
348	0.29
349	0.23
350	0.25
351	0.23
352	0.2
353	0.19
354	0.15
355	0.16
356	0.15
357	0.15
358	0.21
359	0.29
360	0.32
361	0.32
362	0.35
363	0.35
364	0.38
365	0.4
366	0.36
367	0.35
368	0.31
369	0.3
370	0.27
371	0.27
372	0.24
373	0.21
374	0.16
375	0.09
376	0.1
377	0.08
378	0.08
379	0.08
380	0.12
381	0.14
382	0.15
383	0.15
384	0.15
385	0.15
386	0.17
387	0.22
388	0.2
389	0.21
390	0.21
391	0.21
392	0.2
393	0.2
394	0.19
395	0.18
396	0.17
397	0.15
398	0.22
399	0.23
400	0.23
401	0.25
402	0.28
403	0.26
404	0.29
405	0.31
406	0.29
407	0.29
408	0.34
409	0.34
410	0.31
411	0.28
412	0.23
413	0.21
414	0.19
415	0.18
416	0.15
417	0.14
418	0.13
419	0.13
420	0.14
421	0.18
422	0.16
423	0.18
424	0.22
425	0.28
426	0.29
427	0.32
428	0.33
429	0.3
430	0.32
431	0.31
432	0.29
433	0.23
434	0.25
435	0.28
436	0.32
437	0.34
438	0.37
439	0.4
440	0.39
441	0.4
442	0.39
443	0.4
444	0.38
445	0.37
446	0.31
447	0.27
448	0.25
449	0.23
450	0.21
451	0.15
452	0.1
453	0.08
454	0.07
455	0.06
456	0.06
457	0.05
458	0.05
459	0.05
460	0.05
461	0.05
462	0.08
463	0.1
464	0.18
465	0.25
466	0.3
467	0.34
468	0.43

A0A6A6YK91

3D AlphaFold-predicted Structure Viewer