Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6XZU7

Protein Details
Accession A0A6A6XZU7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
51-74SLTSASPPKKKPPRHKVLSSYPTVHydrophilic
NLS Segment(s)
PositionSequence
58-65PKKKPPRH
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MIARYWLRCWDEVSIVPKLNPWCHQAVPNSPTALFSSNPHRQPTSSINRPSLTSASPPKKKPPRHKVLSSYPTVSRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.28
4 0.3
5 0.3
6 0.31
7 0.29
8 0.29
9 0.28
10 0.28
11 0.32
12 0.32
13 0.35
14 0.34
15 0.34
16 0.31
17 0.27
18 0.26
19 0.23
20 0.21
21 0.15
22 0.14
23 0.19
24 0.25
25 0.28
26 0.29
27 0.28
28 0.27
29 0.3
30 0.37
31 0.38
32 0.39
33 0.41
34 0.43
35 0.43
36 0.44
37 0.42
38 0.36
39 0.28
40 0.25
41 0.31
42 0.37
43 0.43
44 0.46
45 0.54
46 0.62
47 0.71
48 0.77
49 0.79
50 0.8
51 0.82
52 0.88
53 0.86
54 0.87
55 0.84
56 0.79
57 0.72
58 0.65