Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YI28

Protein Details
Accession A0A6A6YI28    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
69-95DISSATRKLRSRSRRRRASLRSSQVLHHydrophilic
NLS Segment(s)
PositionSequence
75-86RKLRSRSRRRRA
Subcellular Location(s) mito 16, nucl 6, cyto 2, golg 2
Family & Domain DBs
Amino Acid Sequences MHVKINTWRKPSFILMLMSLQRFLDVWASPTRDRLQLNSNPQISIPGWERSLEEGNSHLEGFQVTASSDISSATRKLRSRSRRRRASLRSSQVLHSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.32
4 0.33
5 0.29
6 0.26
7 0.21
8 0.17
9 0.15
10 0.14
11 0.12
12 0.09
13 0.11
14 0.15
15 0.19
16 0.19
17 0.22
18 0.24
19 0.26
20 0.26
21 0.26
22 0.29
23 0.32
24 0.39
25 0.42
26 0.4
27 0.36
28 0.35
29 0.35
30 0.28
31 0.24
32 0.2
33 0.15
34 0.14
35 0.15
36 0.15
37 0.15
38 0.17
39 0.14
40 0.12
41 0.11
42 0.13
43 0.13
44 0.12
45 0.1
46 0.08
47 0.07
48 0.07
49 0.06
50 0.05
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.11
60 0.14
61 0.2
62 0.24
63 0.3
64 0.4
65 0.5
66 0.6
67 0.69
68 0.76
69 0.81
70 0.86
71 0.91
72 0.9
73 0.9
74 0.89
75 0.87
76 0.84
77 0.76