Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Y5T7

Protein Details
Accession A0A6A6Y5T7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
323-347RVDHTDKNSKKKPLTRKQMNALELSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006886  RNA_pol_III_Rpc5  
Gene Ontology GO:0005634  C:nucleus  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04801  RPC5  
Amino Acid Sequences MAPAATDFEEVDPVIAEYDVFLTPDLEEETYLLQYLNRAKEQPYNERHDMCPLELRMKQESGFIEVDVPVNVHMNFNRLNGVKWGESLRKAKEDGQTAFGVTAGFERPQVRTGLARGGLARGGARGGGTARGRTATAEPAKEKKDDDEDEELKELLYRFDDANEKGHVLNKQTLGGQILKQEEGEPKYMVGAFRGKELHLTKLSGIVQMRPQFHHLDALMQQEQAARRAESDAANPNKQSGPRAVQIQLKNSDLENKDMASTKQLLKAAAEEKWMKLRYHDEDSAEAYSAYREKLFVQDIKAAPKLHSVMNNEEYLEIISAPRVDHTDKNSKKKPLTRKQMNALELSDTEDEEEGQDEEMAEETQAPNDAPVDSMDIDATDVDTTEVSNEINDLLTASQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.08
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.1
12 0.12
13 0.1
14 0.1
15 0.1
16 0.12
17 0.11
18 0.12
19 0.1
20 0.09
21 0.13
22 0.2
23 0.24
24 0.26
25 0.28
26 0.3
27 0.37
28 0.44
29 0.5
30 0.51
31 0.55
32 0.58
33 0.59
34 0.58
35 0.58
36 0.53
37 0.45
38 0.44
39 0.38
40 0.38
41 0.37
42 0.4
43 0.36
44 0.36
45 0.34
46 0.31
47 0.3
48 0.28
49 0.26
50 0.22
51 0.2
52 0.18
53 0.19
54 0.14
55 0.13
56 0.09
57 0.11
58 0.11
59 0.12
60 0.12
61 0.15
62 0.16
63 0.17
64 0.22
65 0.2
66 0.21
67 0.22
68 0.25
69 0.22
70 0.22
71 0.27
72 0.26
73 0.32
74 0.36
75 0.37
76 0.37
77 0.39
78 0.42
79 0.43
80 0.46
81 0.42
82 0.4
83 0.36
84 0.32
85 0.3
86 0.25
87 0.19
88 0.11
89 0.11
90 0.08
91 0.08
92 0.1
93 0.12
94 0.13
95 0.15
96 0.16
97 0.16
98 0.16
99 0.17
100 0.2
101 0.19
102 0.19
103 0.18
104 0.17
105 0.16
106 0.15
107 0.13
108 0.09
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.11
115 0.12
116 0.12
117 0.13
118 0.13
119 0.14
120 0.15
121 0.16
122 0.18
123 0.21
124 0.24
125 0.26
126 0.31
127 0.33
128 0.33
129 0.32
130 0.28
131 0.31
132 0.3
133 0.31
134 0.33
135 0.32
136 0.32
137 0.32
138 0.29
139 0.22
140 0.21
141 0.17
142 0.1
143 0.09
144 0.09
145 0.08
146 0.1
147 0.14
148 0.14
149 0.16
150 0.16
151 0.16
152 0.16
153 0.19
154 0.19
155 0.18
156 0.21
157 0.19
158 0.19
159 0.19
160 0.19
161 0.18
162 0.17
163 0.15
164 0.15
165 0.15
166 0.14
167 0.14
168 0.15
169 0.16
170 0.17
171 0.18
172 0.14
173 0.13
174 0.14
175 0.15
176 0.13
177 0.11
178 0.13
179 0.11
180 0.13
181 0.14
182 0.13
183 0.18
184 0.19
185 0.21
186 0.18
187 0.19
188 0.17
189 0.2
190 0.2
191 0.18
192 0.17
193 0.14
194 0.18
195 0.22
196 0.23
197 0.21
198 0.23
199 0.22
200 0.22
201 0.22
202 0.18
203 0.16
204 0.16
205 0.19
206 0.17
207 0.15
208 0.15
209 0.15
210 0.15
211 0.16
212 0.16
213 0.12
214 0.12
215 0.13
216 0.14
217 0.13
218 0.16
219 0.21
220 0.24
221 0.26
222 0.25
223 0.26
224 0.26
225 0.26
226 0.25
227 0.21
228 0.22
229 0.23
230 0.26
231 0.28
232 0.32
233 0.34
234 0.38
235 0.36
236 0.33
237 0.31
238 0.28
239 0.32
240 0.26
241 0.26
242 0.21
243 0.19
244 0.19
245 0.2
246 0.2
247 0.16
248 0.18
249 0.18
250 0.21
251 0.22
252 0.21
253 0.2
254 0.24
255 0.23
256 0.21
257 0.23
258 0.2
259 0.2
260 0.27
261 0.3
262 0.26
263 0.26
264 0.32
265 0.33
266 0.38
267 0.4
268 0.34
269 0.33
270 0.35
271 0.33
272 0.27
273 0.21
274 0.14
275 0.13
276 0.12
277 0.12
278 0.1
279 0.09
280 0.1
281 0.14
282 0.18
283 0.19
284 0.21
285 0.27
286 0.29
287 0.32
288 0.36
289 0.33
290 0.29
291 0.31
292 0.3
293 0.26
294 0.3
295 0.29
296 0.32
297 0.34
298 0.34
299 0.3
300 0.28
301 0.25
302 0.2
303 0.16
304 0.1
305 0.07
306 0.07
307 0.08
308 0.08
309 0.09
310 0.11
311 0.14
312 0.18
313 0.25
314 0.36
315 0.43
316 0.53
317 0.6
318 0.66
319 0.71
320 0.76
321 0.8
322 0.8
323 0.83
324 0.84
325 0.85
326 0.86
327 0.86
328 0.8
329 0.72
330 0.62
331 0.54
332 0.43
333 0.38
334 0.29
335 0.2
336 0.18
337 0.15
338 0.14
339 0.11
340 0.12
341 0.09
342 0.08
343 0.09
344 0.08
345 0.08
346 0.09
347 0.08
348 0.07
349 0.08
350 0.08
351 0.09
352 0.1
353 0.1
354 0.09
355 0.1
356 0.1
357 0.09
358 0.1
359 0.12
360 0.12
361 0.12
362 0.12
363 0.11
364 0.11
365 0.1
366 0.1
367 0.07
368 0.06
369 0.07
370 0.06
371 0.07
372 0.07
373 0.08
374 0.07
375 0.07
376 0.07
377 0.07
378 0.08
379 0.07
380 0.08