Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YVM8

Protein Details
Accession A0A6A6YVM8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
4-25QLTPLPKSRRGWKPRCYIPPTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSIQLTPLPKSRRGWKPRCYIPPTLLLPTLRVGQHRFASSPPSSDLYKPYSDKDQRIEEDLFLVELRVKRKLKWKEVQLGFLQRYKRAYNSSTLQMRLVRIQKRPGDSHKSGTSQNIDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.78
4 0.82
5 0.86
6 0.82
7 0.77
8 0.7
9 0.68
10 0.62
11 0.55
12 0.49
13 0.39
14 0.34
15 0.3
16 0.3
17 0.23
18 0.22
19 0.22
20 0.23
21 0.26
22 0.26
23 0.25
24 0.22
25 0.27
26 0.25
27 0.24
28 0.22
29 0.21
30 0.21
31 0.21
32 0.24
33 0.21
34 0.24
35 0.23
36 0.23
37 0.3
38 0.33
39 0.35
40 0.36
41 0.37
42 0.34
43 0.37
44 0.36
45 0.26
46 0.23
47 0.2
48 0.15
49 0.1
50 0.09
51 0.07
52 0.09
53 0.11
54 0.17
55 0.18
56 0.21
57 0.31
58 0.4
59 0.47
60 0.53
61 0.59
62 0.62
63 0.63
64 0.65
65 0.59
66 0.58
67 0.5
68 0.46
69 0.41
70 0.33
71 0.34
72 0.32
73 0.31
74 0.29
75 0.29
76 0.31
77 0.33
78 0.39
79 0.39
80 0.39
81 0.38
82 0.36
83 0.36
84 0.37
85 0.4
86 0.38
87 0.4
88 0.47
89 0.5
90 0.54
91 0.59
92 0.61
93 0.63
94 0.61
95 0.63
96 0.61
97 0.58
98 0.55
99 0.54
100 0.51