Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YAB1

Protein Details
Accession A0A6A6YAB1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
150-173LQQPQTPRPPRQLRPQPREIRPLTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, nucl 7, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036378  FAS1_dom_sf  
IPR000782  FAS1_domain  
Pfam View protein in Pfam  
PF02469  Fasciclin  
PROSITE View protein in PROSITE  
PS50213  FAS1  
Amino Acid Sequences MMYRFSTAVVLSSALSANAKTFLEAIGAYPQLSNFTTFVKTNKAIFPFSADSPLTVLVPDDNAFANYKKTYGVEVTSLPPADLAPLFSSHLLVGALNGDNFTNPAGTTCPTLLTSPQYSNRTASGTLPAQDRQRIQELRPSPLHLLRLLLQQPQTPRPPRQLRPQPREIRPLTPPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.09
5 0.11
6 0.1
7 0.1
8 0.1
9 0.09
10 0.1
11 0.1
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.11
18 0.12
19 0.13
20 0.14
21 0.11
22 0.13
23 0.15
24 0.16
25 0.18
26 0.22
27 0.23
28 0.25
29 0.29
30 0.29
31 0.28
32 0.27
33 0.3
34 0.27
35 0.25
36 0.27
37 0.22
38 0.19
39 0.19
40 0.19
41 0.14
42 0.1
43 0.1
44 0.06
45 0.07
46 0.07
47 0.07
48 0.06
49 0.07
50 0.09
51 0.09
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.12
58 0.12
59 0.12
60 0.11
61 0.12
62 0.14
63 0.14
64 0.14
65 0.12
66 0.1
67 0.09
68 0.08
69 0.07
70 0.06
71 0.05
72 0.06
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.04
84 0.05
85 0.04
86 0.04
87 0.05
88 0.05
89 0.04
90 0.04
91 0.05
92 0.06
93 0.07
94 0.08
95 0.08
96 0.09
97 0.09
98 0.1
99 0.11
100 0.13
101 0.15
102 0.18
103 0.24
104 0.26
105 0.26
106 0.27
107 0.27
108 0.26
109 0.24
110 0.21
111 0.2
112 0.19
113 0.2
114 0.21
115 0.24
116 0.25
117 0.28
118 0.28
119 0.27
120 0.34
121 0.34
122 0.32
123 0.38
124 0.38
125 0.4
126 0.41
127 0.41
128 0.37
129 0.38
130 0.39
131 0.31
132 0.3
133 0.26
134 0.31
135 0.29
136 0.29
137 0.27
138 0.29
139 0.33
140 0.37
141 0.44
142 0.44
143 0.48
144 0.54
145 0.62
146 0.66
147 0.72
148 0.77
149 0.79
150 0.81
151 0.86
152 0.85
153 0.83
154 0.86
155 0.79
156 0.74
157 0.7