Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Z5G9

Protein Details
Accession A0A6A6Z5G9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-97SQREHHSKHTHQNQHKRYRNLDYPKNKAHKKPKRIQDSMPNPIPHydrophilic
NLS Segment(s)
PositionSequence
78-87KNKAHKKPKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MADGASEMNEYKAEGDIKGYFPSASTLTGRKAACTKTSPIPLINDGYCFPLVESQREHHSKHTHQNQHKRYRNLDYPKNKAHKKPKRIQDSMPNPIPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.14
4 0.16
5 0.16
6 0.16
7 0.14
8 0.13
9 0.15
10 0.13
11 0.13
12 0.14
13 0.15
14 0.16
15 0.22
16 0.22
17 0.21
18 0.24
19 0.24
20 0.26
21 0.27
22 0.29
23 0.29
24 0.33
25 0.33
26 0.3
27 0.3
28 0.28
29 0.28
30 0.24
31 0.19
32 0.15
33 0.16
34 0.14
35 0.12
36 0.1
37 0.12
38 0.13
39 0.13
40 0.15
41 0.15
42 0.22
43 0.25
44 0.26
45 0.28
46 0.34
47 0.37
48 0.46
49 0.54
50 0.57
51 0.64
52 0.73
53 0.77
54 0.81
55 0.84
56 0.8
57 0.76
58 0.75
59 0.75
60 0.74
61 0.74
62 0.72
63 0.72
64 0.76
65 0.8
66 0.78
67 0.79
68 0.81
69 0.81
70 0.83
71 0.85
72 0.85
73 0.86
74 0.85
75 0.84
76 0.84
77 0.83
78 0.82