Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4PCX9

Protein Details
Accession F4PCX9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-111DKEFSLEKKKKQRKPSPIRKITLKKABasic
NLS Segment(s)
PositionSequence
93-112KKKKQRKPSPIRKITLKKAK
Subcellular Location(s) nucl 15, mito_nucl 10.833, cyto_nucl 10.333, mito 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MLYCNWQSKASGVGLDIFGANPSQTNGEKYQCFNCQNLFPSVRFAPHLEKCLGLGRTSSRVASRKIASSERLSSPTPGMNNDSDTDKEFSLEKKKKQRKPSPIRKITLKKAKTDGSPGSSQFIKKVKLSKPLGTSGYLPFQSHPGSSLTQIVAKGGRADDDSSAYAPSDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.1
5 0.1
6 0.09
7 0.08
8 0.07
9 0.07
10 0.11
11 0.12
12 0.16
13 0.19
14 0.24
15 0.27
16 0.29
17 0.33
18 0.37
19 0.39
20 0.37
21 0.36
22 0.35
23 0.36
24 0.39
25 0.36
26 0.29
27 0.32
28 0.31
29 0.29
30 0.27
31 0.26
32 0.28
33 0.28
34 0.31
35 0.27
36 0.26
37 0.26
38 0.3
39 0.28
40 0.21
41 0.19
42 0.18
43 0.21
44 0.21
45 0.21
46 0.2
47 0.23
48 0.25
49 0.29
50 0.28
51 0.28
52 0.31
53 0.32
54 0.31
55 0.31
56 0.32
57 0.29
58 0.3
59 0.27
60 0.25
61 0.23
62 0.22
63 0.19
64 0.17
65 0.17
66 0.15
67 0.15
68 0.15
69 0.15
70 0.14
71 0.15
72 0.15
73 0.12
74 0.12
75 0.12
76 0.14
77 0.23
78 0.28
79 0.33
80 0.43
81 0.53
82 0.6
83 0.7
84 0.78
85 0.79
86 0.84
87 0.88
88 0.89
89 0.88
90 0.85
91 0.84
92 0.81
93 0.8
94 0.79
95 0.71
96 0.64
97 0.61
98 0.6
99 0.52
100 0.51
101 0.45
102 0.39
103 0.39
104 0.35
105 0.32
106 0.3
107 0.29
108 0.27
109 0.28
110 0.26
111 0.27
112 0.34
113 0.36
114 0.44
115 0.49
116 0.5
117 0.49
118 0.52
119 0.5
120 0.44
121 0.41
122 0.34
123 0.35
124 0.3
125 0.26
126 0.22
127 0.23
128 0.22
129 0.2
130 0.19
131 0.16
132 0.16
133 0.17
134 0.19
135 0.17
136 0.18
137 0.18
138 0.19
139 0.17
140 0.16
141 0.17
142 0.15
143 0.16
144 0.15
145 0.17
146 0.16
147 0.18
148 0.19
149 0.17
150 0.18
151 0.16