Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4PCQ9

Protein Details
Accession F4PCQ9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-49PVSLNQTKIVKKRTKKFSRHQSDRYKKIDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-49KKRTKKFSRHQSDRYKKIDASWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPVSLNQTKIVKKRTKKFSRHQSDRYKKIDASWRKPKGIDNRVRRRFKGQIAMPKIGYGSNAKTRHVMPNGFKKFLINNVQDLELLLMHNRVFAAEVAHGVSCRKRALIVERAQQLDIKLTNAGARLRTVENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.84
4 0.88
5 0.89
6 0.91
7 0.91
8 0.91
9 0.91
10 0.91
11 0.9
12 0.84
13 0.78
14 0.68
15 0.64
16 0.64
17 0.63
18 0.62
19 0.64
20 0.65
21 0.63
22 0.64
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.7
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.58
40 0.5
41 0.44
42 0.38
43 0.29
44 0.24
45 0.17
46 0.14
47 0.2
48 0.21
49 0.21
50 0.23
51 0.24
52 0.29
53 0.3
54 0.3
55 0.26
56 0.36
57 0.39
58 0.38
59 0.37
60 0.32
61 0.3
62 0.32
63 0.35
64 0.26
65 0.25
66 0.24
67 0.25
68 0.24
69 0.23
70 0.17
71 0.09
72 0.08
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.11
89 0.12
90 0.13
91 0.13
92 0.13
93 0.18
94 0.25
95 0.32
96 0.37
97 0.42
98 0.47
99 0.48
100 0.47
101 0.44
102 0.38
103 0.34
104 0.28
105 0.22
106 0.17
107 0.16
108 0.17
109 0.19
110 0.21
111 0.17
112 0.18
113 0.2