Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Z022

Protein Details
Accession A0A6A6Z022    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-31ESKNSSQHNQAKKNHRNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
12-59KKNHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences ESKNSSQHNQAKKNHRNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.81
4 0.83
5 0.85
6 0.84
7 0.83
8 0.82
9 0.84
10 0.84
11 0.82
12 0.81
13 0.78
14 0.75
15 0.7
16 0.68
17 0.62
18 0.57
19 0.53
20 0.55
21 0.5
22 0.52
23 0.56
24 0.58
25 0.63
26 0.65
27 0.72
28 0.65
29 0.71
30 0.65
31 0.65
32 0.64
33 0.57
34 0.53
35 0.48
36 0.45
37 0.39
38 0.38
39 0.31
40 0.31
41 0.36
42 0.4
43 0.45