Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YYP3

Protein Details
Accession A0A6A6YYP3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-109RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) nucl 11.5, mito_nucl 11, mito 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFPEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVNPQQANARPAAAGAAPAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.79
4 0.77
5 0.77
6 0.83
7 0.84
8 0.81
9 0.73
10 0.72
11 0.7
12 0.7
13 0.69
14 0.67
15 0.64
16 0.65
17 0.68
18 0.7
19 0.72
20 0.71
21 0.73
22 0.74
23 0.75
24 0.72
25 0.73
26 0.68
27 0.68
28 0.6
29 0.53
30 0.46
31 0.37
32 0.35
33 0.28
34 0.25
35 0.16
36 0.15
37 0.12
38 0.1
39 0.1
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.1
50 0.11
51 0.1
52 0.1
53 0.11
54 0.14
55 0.18
56 0.2
57 0.21
58 0.24
59 0.24
60 0.24
61 0.25
62 0.23
63 0.18
64 0.18
65 0.17
66 0.18
67 0.18
68 0.19
69 0.2
70 0.26
71 0.29
72 0.3
73 0.33
74 0.38
75 0.47
76 0.53
77 0.59
78 0.63
79 0.67
80 0.73
81 0.78
82 0.79
83 0.78
84 0.78
85 0.78
86 0.78
87 0.79
88 0.77
89 0.77
90 0.77
91 0.79
92 0.78
93 0.79
94 0.72
95 0.74
96 0.78
97 0.79
98 0.75
99 0.7
100 0.71
101 0.7
102 0.72
103 0.62
104 0.53
105 0.43
106 0.36
107 0.33
108 0.23
109 0.15