Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Y5X4

Protein Details
Accession A0A6A6Y5X4    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-37AATGAKRAYYRKKRAFEKGRQPANTRHydrophilic
NLS Segment(s)
PositionSequence
8-56RHKRAATGAKRAYYRKKRAFEKGRQPANTRIGAKRIHLVRTRGGNRKFR
123-149RRRQVKGAEKEEEKKRSKSVEKKHAAR
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRAATGAKRAYYRKKRAFEKGRQPANTRIGAKRIHLVRTRGGNRKFRALRLDSGNFSWGSEGIAKKVRVIAVAFHPSNNELVRTNTLTKSAVVQIDAAPFRQWYEAHYGTQLGRRRQVKGAEKEEEKKRSKSVEKKHAARVAATGKVESALEKQFEAGRLFAVVASRPGQSGRVDGYVLEGEELAFYSRAIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.65
3 0.63
4 0.66
5 0.71
6 0.72
7 0.72
8 0.75
9 0.74
10 0.77
11 0.79
12 0.84
13 0.87
14 0.86
15 0.87
16 0.86
17 0.86
18 0.83
19 0.79
20 0.77
21 0.73
22 0.69
23 0.62
24 0.55
25 0.51
26 0.48
27 0.45
28 0.43
29 0.41
30 0.41
31 0.43
32 0.43
33 0.43
34 0.5
35 0.56
36 0.58
37 0.62
38 0.63
39 0.6
40 0.67
41 0.64
42 0.58
43 0.59
44 0.53
45 0.51
46 0.49
47 0.51
48 0.42
49 0.4
50 0.38
51 0.3
52 0.26
53 0.21
54 0.13
55 0.11
56 0.12
57 0.11
58 0.12
59 0.18
60 0.18
61 0.18
62 0.2
63 0.19
64 0.17
65 0.17
66 0.16
67 0.15
68 0.21
69 0.21
70 0.19
71 0.19
72 0.19
73 0.2
74 0.18
75 0.15
76 0.09
77 0.11
78 0.13
79 0.15
80 0.17
81 0.15
82 0.16
83 0.16
84 0.15
85 0.15
86 0.15
87 0.12
88 0.11
89 0.11
90 0.1
91 0.12
92 0.12
93 0.11
94 0.09
95 0.09
96 0.09
97 0.1
98 0.09
99 0.08
100 0.15
101 0.16
102 0.17
103 0.17
104 0.18
105 0.18
106 0.24
107 0.27
108 0.23
109 0.28
110 0.31
111 0.33
112 0.37
113 0.44
114 0.48
115 0.51
116 0.55
117 0.54
118 0.56
119 0.6
120 0.64
121 0.64
122 0.6
123 0.54
124 0.52
125 0.54
126 0.59
127 0.61
128 0.64
129 0.66
130 0.7
131 0.73
132 0.78
133 0.75
134 0.66
135 0.57
136 0.52
137 0.45
138 0.4
139 0.34
140 0.26
141 0.21
142 0.2
143 0.2
144 0.15
145 0.14
146 0.13
147 0.14
148 0.14
149 0.15
150 0.16
151 0.19
152 0.19
153 0.16
154 0.14
155 0.13
156 0.13
157 0.13
158 0.12
159 0.1
160 0.11
161 0.12
162 0.12
163 0.13
164 0.13
165 0.15
166 0.15
167 0.17
168 0.17
169 0.18
170 0.17
171 0.17
172 0.19
173 0.18
174 0.17
175 0.14
176 0.11
177 0.09
178 0.09
179 0.1
180 0.08
181 0.07
182 0.07