Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NVJ7

Protein Details
Accession F4NVJ7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
93-116VVMTDKDWENRKRRNPNRNPGVLPHydrophilic
337-373SLDPTPPPKKPSPKLPKKSSPKPPNKTGPKPLNLKKWHydrophilic
NLS Segment(s)
PositionSequence
341-373TPPPKKPSPKLPKKSSPKPPNKTGPKPLNLKKW
Subcellular Location(s) extr 19, E.R. 3, mito 2, pero 1, golg 1, vacu 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MKFTTFAVGSLLVISSSAAVIPSAYRDHGIARLERRAGEEPDDGSLSRNSGHRNAIKKKPVPAPGSGSGSGSGSGSAPGSGPVPAPGSVPGDVVMTDKDWENRKRRNPNRNPGVLPPKSDVVYADIDHGNPPRDRKPRPSAPKGGNEVIYADINHSPNSNPKNGNKPIRMNSDSGSDFEDIRQVRKDIEDLKAKQNGPQPPGSSDRSNPPALPPRNNPGPSNSPTRPSDTPIPAPRKKPILQPPSDQSGTPALPPKMGKKPILQPPSDQSGPPSLPPKVGKKPILQPPSDQSNPPSLPPKVGKRPGPSGSSGSSSPPVPPRQSAHQEPPVPPKRVESLDPTPPPKKPSPKLPKKSSPKPPNKTGPKPLNLKKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.06
9 0.09
10 0.1
11 0.11
12 0.12
13 0.13
14 0.15
15 0.19
16 0.23
17 0.27
18 0.3
19 0.35
20 0.37
21 0.37
22 0.4
23 0.41
24 0.4
25 0.38
26 0.36
27 0.3
28 0.3
29 0.31
30 0.25
31 0.23
32 0.21
33 0.17
34 0.16
35 0.19
36 0.2
37 0.23
38 0.31
39 0.35
40 0.44
41 0.52
42 0.6
43 0.66
44 0.67
45 0.71
46 0.71
47 0.74
48 0.68
49 0.64
50 0.61
51 0.57
52 0.57
53 0.49
54 0.42
55 0.34
56 0.3
57 0.26
58 0.18
59 0.13
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.1
71 0.1
72 0.11
73 0.12
74 0.13
75 0.13
76 0.13
77 0.12
78 0.11
79 0.1
80 0.11
81 0.1
82 0.08
83 0.08
84 0.1
85 0.14
86 0.21
87 0.29
88 0.37
89 0.46
90 0.55
91 0.66
92 0.75
93 0.81
94 0.85
95 0.88
96 0.89
97 0.86
98 0.8
99 0.77
100 0.77
101 0.68
102 0.6
103 0.51
104 0.44
105 0.37
106 0.34
107 0.26
108 0.19
109 0.19
110 0.16
111 0.16
112 0.15
113 0.14
114 0.16
115 0.18
116 0.18
117 0.18
118 0.22
119 0.27
120 0.35
121 0.39
122 0.46
123 0.54
124 0.61
125 0.69
126 0.73
127 0.74
128 0.72
129 0.75
130 0.72
131 0.64
132 0.55
133 0.45
134 0.37
135 0.3
136 0.24
137 0.16
138 0.12
139 0.12
140 0.12
141 0.12
142 0.12
143 0.11
144 0.17
145 0.2
146 0.23
147 0.25
148 0.28
149 0.37
150 0.44
151 0.51
152 0.5
153 0.53
154 0.54
155 0.58
156 0.57
157 0.49
158 0.42
159 0.39
160 0.34
161 0.28
162 0.25
163 0.18
164 0.15
165 0.14
166 0.17
167 0.13
168 0.14
169 0.15
170 0.13
171 0.13
172 0.13
173 0.16
174 0.14
175 0.19
176 0.25
177 0.26
178 0.31
179 0.36
180 0.36
181 0.38
182 0.41
183 0.41
184 0.36
185 0.37
186 0.33
187 0.3
188 0.35
189 0.34
190 0.3
191 0.27
192 0.29
193 0.3
194 0.3
195 0.27
196 0.27
197 0.33
198 0.35
199 0.38
200 0.37
201 0.39
202 0.46
203 0.47
204 0.44
205 0.4
206 0.42
207 0.4
208 0.45
209 0.4
210 0.37
211 0.36
212 0.41
213 0.36
214 0.35
215 0.38
216 0.34
217 0.4
218 0.44
219 0.51
220 0.51
221 0.53
222 0.53
223 0.53
224 0.52
225 0.54
226 0.56
227 0.57
228 0.56
229 0.58
230 0.58
231 0.57
232 0.55
233 0.46
234 0.38
235 0.32
236 0.28
237 0.25
238 0.27
239 0.2
240 0.23
241 0.24
242 0.28
243 0.33
244 0.37
245 0.38
246 0.38
247 0.46
248 0.53
249 0.58
250 0.54
251 0.49
252 0.48
253 0.52
254 0.47
255 0.38
256 0.31
257 0.3
258 0.29
259 0.29
260 0.29
261 0.23
262 0.27
263 0.32
264 0.38
265 0.41
266 0.48
267 0.5
268 0.52
269 0.6
270 0.65
271 0.67
272 0.61
273 0.56
274 0.54
275 0.57
276 0.53
277 0.45
278 0.38
279 0.4
280 0.39
281 0.39
282 0.39
283 0.32
284 0.36
285 0.41
286 0.48
287 0.49
288 0.56
289 0.6
290 0.6
291 0.67
292 0.66
293 0.63
294 0.57
295 0.51
296 0.46
297 0.42
298 0.36
299 0.31
300 0.28
301 0.25
302 0.26
303 0.29
304 0.32
305 0.33
306 0.36
307 0.38
308 0.45
309 0.53
310 0.56
311 0.58
312 0.61
313 0.63
314 0.63
315 0.69
316 0.69
317 0.65
318 0.59
319 0.54
320 0.51
321 0.5
322 0.49
323 0.46
324 0.44
325 0.5
326 0.55
327 0.58
328 0.57
329 0.57
330 0.61
331 0.62
332 0.66
333 0.63
334 0.68
335 0.72
336 0.78
337 0.85
338 0.88
339 0.9
340 0.9
341 0.93
342 0.93
343 0.93
344 0.93
345 0.91
346 0.91
347 0.91
348 0.91
349 0.9
350 0.9
351 0.89
352 0.87
353 0.88