Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YJ47

Protein Details
Accession A0A6A6YJ47    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-51TGPPVKGTGKNTHKRRTRKQQMKEKSIWDIHydrophilic
370-392ERGVNPGREKRARRGWRRGGVLGBasic
NLS Segment(s)
PositionSequence
34-40HKRRTRK
375-388PGREKRARRGWRRG
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
Amino Acid Sequences MSKKTPFSNIHDTKDEDLWTYTGPPVKGTGKNTHKRRTRKQQMKEKSIWDIPAKPVVQESVEDLEGWRSFKGPSFRPKKAMSAGNSIVPKKPVLKRRSEEDLWAIPTTEKDFNEQASKMEDVVWSSKPTEVRNPPSSGFEPPNLVDPKAYTTMPKASTPPDPMQIKVSETIWRLEREQARLPPQPPQSAPSTLTSPKTETTAPPPFSLLLSLPTELQLSITDLLPTETILALRTTCHHLHTLLPPPSLGPLLALERTPWARNRRFPLWTCSLCLRLRPAPAFADTMVRGARGLNGKEPHKRFCVACGIRPDPGTRASRYAPGSEVIVSGVRHVFCRECRGYERELGGKGTGVCRGCHEEMGLGGMVRGVERGVNPGREKRARRGWRRGGVLGGRDPYGYESEDCELLDGYDSDFWESYDPAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.47
3 0.38
4 0.33
5 0.27
6 0.23
7 0.22
8 0.22
9 0.24
10 0.23
11 0.21
12 0.24
13 0.3
14 0.34
15 0.38
16 0.45
17 0.51
18 0.61
19 0.69
20 0.74
21 0.77
22 0.82
23 0.87
24 0.88
25 0.89
26 0.9
27 0.91
28 0.92
29 0.94
30 0.93
31 0.89
32 0.83
33 0.79
34 0.73
35 0.68
36 0.62
37 0.56
38 0.5
39 0.5
40 0.45
41 0.38
42 0.34
43 0.3
44 0.26
45 0.22
46 0.22
47 0.17
48 0.17
49 0.17
50 0.16
51 0.18
52 0.18
53 0.18
54 0.15
55 0.13
56 0.13
57 0.19
58 0.25
59 0.29
60 0.38
61 0.46
62 0.51
63 0.57
64 0.59
65 0.61
66 0.61
67 0.61
68 0.55
69 0.54
70 0.51
71 0.5
72 0.51
73 0.46
74 0.42
75 0.36
76 0.33
77 0.33
78 0.39
79 0.43
80 0.45
81 0.54
82 0.56
83 0.61
84 0.67
85 0.61
86 0.58
87 0.54
88 0.51
89 0.44
90 0.39
91 0.33
92 0.25
93 0.24
94 0.24
95 0.23
96 0.19
97 0.2
98 0.21
99 0.22
100 0.27
101 0.26
102 0.23
103 0.21
104 0.22
105 0.18
106 0.18
107 0.16
108 0.13
109 0.16
110 0.16
111 0.15
112 0.15
113 0.18
114 0.19
115 0.21
116 0.29
117 0.34
118 0.4
119 0.44
120 0.46
121 0.44
122 0.47
123 0.46
124 0.42
125 0.37
126 0.3
127 0.27
128 0.24
129 0.31
130 0.27
131 0.25
132 0.21
133 0.19
134 0.21
135 0.21
136 0.21
137 0.14
138 0.16
139 0.21
140 0.23
141 0.23
142 0.22
143 0.22
144 0.26
145 0.3
146 0.3
147 0.31
148 0.31
149 0.3
150 0.31
151 0.3
152 0.27
153 0.23
154 0.22
155 0.19
156 0.19
157 0.2
158 0.2
159 0.2
160 0.2
161 0.25
162 0.28
163 0.28
164 0.32
165 0.34
166 0.37
167 0.41
168 0.41
169 0.42
170 0.42
171 0.41
172 0.36
173 0.34
174 0.32
175 0.29
176 0.3
177 0.24
178 0.24
179 0.23
180 0.24
181 0.23
182 0.21
183 0.19
184 0.2
185 0.19
186 0.16
187 0.22
188 0.27
189 0.27
190 0.26
191 0.26
192 0.24
193 0.23
194 0.22
195 0.15
196 0.1
197 0.1
198 0.1
199 0.09
200 0.09
201 0.09
202 0.08
203 0.08
204 0.06
205 0.06
206 0.06
207 0.07
208 0.06
209 0.06
210 0.07
211 0.06
212 0.06
213 0.05
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.07
221 0.11
222 0.12
223 0.14
224 0.14
225 0.14
226 0.17
227 0.22
228 0.29
229 0.27
230 0.27
231 0.25
232 0.24
233 0.24
234 0.22
235 0.17
236 0.08
237 0.06
238 0.08
239 0.09
240 0.08
241 0.08
242 0.1
243 0.12
244 0.14
245 0.19
246 0.26
247 0.32
248 0.38
249 0.45
250 0.48
251 0.53
252 0.53
253 0.55
254 0.54
255 0.5
256 0.46
257 0.41
258 0.42
259 0.36
260 0.35
261 0.33
262 0.28
263 0.31
264 0.3
265 0.3
266 0.26
267 0.27
268 0.26
269 0.22
270 0.22
271 0.17
272 0.18
273 0.15
274 0.13
275 0.12
276 0.11
277 0.14
278 0.16
279 0.17
280 0.21
281 0.26
282 0.31
283 0.4
284 0.44
285 0.45
286 0.44
287 0.46
288 0.4
289 0.39
290 0.45
291 0.39
292 0.4
293 0.44
294 0.42
295 0.42
296 0.43
297 0.4
298 0.31
299 0.35
300 0.33
301 0.27
302 0.29
303 0.28
304 0.33
305 0.34
306 0.33
307 0.28
308 0.25
309 0.24
310 0.2
311 0.18
312 0.13
313 0.13
314 0.11
315 0.12
316 0.14
317 0.13
318 0.13
319 0.15
320 0.18
321 0.19
322 0.28
323 0.29
324 0.3
325 0.35
326 0.39
327 0.41
328 0.42
329 0.44
330 0.4
331 0.39
332 0.36
333 0.31
334 0.29
335 0.26
336 0.22
337 0.23
338 0.2
339 0.19
340 0.21
341 0.28
342 0.27
343 0.26
344 0.25
345 0.21
346 0.2
347 0.21
348 0.18
349 0.11
350 0.09
351 0.09
352 0.08
353 0.08
354 0.08
355 0.05
356 0.07
357 0.07
358 0.14
359 0.18
360 0.24
361 0.29
362 0.36
363 0.45
364 0.53
365 0.58
366 0.61
367 0.67
368 0.72
369 0.78
370 0.82
371 0.83
372 0.83
373 0.84
374 0.78
375 0.75
376 0.7
377 0.65
378 0.59
379 0.51
380 0.43
381 0.36
382 0.34
383 0.28
384 0.25
385 0.22
386 0.17
387 0.18
388 0.19
389 0.2
390 0.19
391 0.17
392 0.15
393 0.13
394 0.14
395 0.11
396 0.11
397 0.12
398 0.13
399 0.14
400 0.14
401 0.14
402 0.14