Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YGN1

Protein Details
Accession A0A6A6YGN1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKRRRQQGSKDGKSERRSRERRLATNERVKRBasic
NLS Segment(s)
PositionSequence
2-36KRRRQQGSKDGKSERRSRERRLATNERVKREKATR
Subcellular Location(s) mito 11cyto 11cyto_mito 11
Family & Domain DBs
Amino Acid Sequences MKRRRQQGSKDGKSERRSRERRLATNERVKREKATRRQVFGERVVVGGMRLETLMAEAEGAASGFKGHATRQGLGDARTAAAATVLPGPWVVFAGALRPKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.79
4 0.77
5 0.77
6 0.79
7 0.79
8 0.79
9 0.8
10 0.79
11 0.78
12 0.81
13 0.79
14 0.76
15 0.71
16 0.65
17 0.62
18 0.61
19 0.62
20 0.61
21 0.66
22 0.65
23 0.65
24 0.68
25 0.67
26 0.62
27 0.55
28 0.48
29 0.37
30 0.3
31 0.26
32 0.21
33 0.15
34 0.11
35 0.08
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.11
56 0.14
57 0.16
58 0.17
59 0.21
60 0.22
61 0.23
62 0.24
63 0.19
64 0.16
65 0.15
66 0.14
67 0.09
68 0.08
69 0.07
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.06
81 0.12
82 0.18