Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Z1E7

Protein Details
Accession A0A6A6Z1E7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPVRRRCERHRSPRRRRPQPVSTSRTPPRBasic
NLS Segment(s)
PositionSequence
9-18RHRSPRRRRP
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPVRRRCERHRSPRRRRPQPVSTSRTPPRSVGYIPSSAAQEDWPPGSAFPCCTSSVLRARRRASPTGDTAVRRVRLLPLVSTWMDPSAATFVSFLRHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.95
4 0.93
5 0.92
6 0.91
7 0.9
8 0.88
9 0.82
10 0.8
11 0.77
12 0.73
13 0.65
14 0.56
15 0.48
16 0.44
17 0.39
18 0.35
19 0.32
20 0.27
21 0.26
22 0.25
23 0.22
24 0.19
25 0.18
26 0.13
27 0.1
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.09
34 0.08
35 0.08
36 0.09
37 0.11
38 0.11
39 0.12
40 0.13
41 0.16
42 0.25
43 0.33
44 0.37
45 0.42
46 0.44
47 0.5
48 0.54
49 0.54
50 0.51
51 0.46
52 0.44
53 0.43
54 0.44
55 0.38
56 0.37
57 0.39
58 0.35
59 0.31
60 0.28
61 0.25
62 0.26
63 0.27
64 0.24
65 0.2
66 0.23
67 0.24
68 0.23
69 0.21
70 0.17
71 0.16
72 0.14
73 0.14
74 0.12
75 0.11
76 0.11
77 0.1
78 0.1