Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YN59

Protein Details
Accession A0A6A6YN59    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-42PSTTPRCHNLRVRLRRRPRPVFATWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 4, extr 4, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MSHKLIERPHFSAAVSQPSTTPRCHNLRVRLRRRPRPVFATWRAPLGQHCLCRGCVHLWEPLRASSPASCPSAAPPHRLSIVIGTVSICGCGVQIRSIECLSAGAAACDIITPALRALPLVRMTKNAANY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.3
4 0.28
5 0.33
6 0.35
7 0.31
8 0.32
9 0.31
10 0.36
11 0.43
12 0.49
13 0.54
14 0.63
15 0.71
16 0.77
17 0.8
18 0.84
19 0.87
20 0.9
21 0.88
22 0.84
23 0.8
24 0.78
25 0.77
26 0.73
27 0.71
28 0.61
29 0.56
30 0.49
31 0.42
32 0.35
33 0.33
34 0.3
35 0.23
36 0.25
37 0.23
38 0.24
39 0.24
40 0.24
41 0.19
42 0.17
43 0.17
44 0.2
45 0.2
46 0.21
47 0.21
48 0.2
49 0.21
50 0.18
51 0.17
52 0.13
53 0.14
54 0.16
55 0.16
56 0.15
57 0.13
58 0.16
59 0.24
60 0.24
61 0.26
62 0.24
63 0.25
64 0.25
65 0.25
66 0.23
67 0.16
68 0.16
69 0.12
70 0.11
71 0.09
72 0.09
73 0.08
74 0.08
75 0.06
76 0.04
77 0.04
78 0.06
79 0.06
80 0.07
81 0.09
82 0.1
83 0.13
84 0.13
85 0.13
86 0.11
87 0.11
88 0.09
89 0.1
90 0.09
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.04
98 0.05
99 0.05
100 0.06
101 0.07
102 0.07
103 0.07
104 0.08
105 0.13
106 0.19
107 0.23
108 0.23
109 0.26
110 0.31