Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YPS7

Protein Details
Accession A0A6A6YPS7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
153-179VLEETKDSLRKKRNKKSAPKKDDESAFHydrophilic
NLS Segment(s)
PositionSequence
26-68SSKSRKPSADSGISKRKQKGLSLAKPGGAQKTKPAAVLKKKRR
161-191LRKKRNKKSAPKKDDESAFSAPPKAKGKMKK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPTKSSKTSSKGSSRPKGNTGATQSSKSRKPSADSGISKRKQKGLSLAKPGGAQKTKPAAVLKKKRRMYSEKELGIPTLNMITPAGVQKVKGQKKGKVFVDDTESMMTILAMVNADKDGQIESKMMRARQLEEIREARRKEAEARSEQKQAVLEETKDSLRKKRNKKSAPKKDDESAFSAPPKAKGKMKKVSFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.74
4 0.72
5 0.7
6 0.65
7 0.63
8 0.6
9 0.6
10 0.54
11 0.53
12 0.54
13 0.54
14 0.56
15 0.54
16 0.54
17 0.48
18 0.5
19 0.53
20 0.55
21 0.57
22 0.58
23 0.61
24 0.65
25 0.67
26 0.68
27 0.65
28 0.64
29 0.57
30 0.55
31 0.57
32 0.57
33 0.59
34 0.61
35 0.59
36 0.54
37 0.53
38 0.51
39 0.48
40 0.4
41 0.33
42 0.3
43 0.34
44 0.33
45 0.34
46 0.37
47 0.38
48 0.46
49 0.56
50 0.6
51 0.64
52 0.69
53 0.7
54 0.73
55 0.72
56 0.7
57 0.7
58 0.69
59 0.62
60 0.58
61 0.54
62 0.47
63 0.4
64 0.31
65 0.21
66 0.12
67 0.09
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.07
75 0.08
76 0.13
77 0.22
78 0.26
79 0.34
80 0.38
81 0.41
82 0.48
83 0.54
84 0.52
85 0.49
86 0.45
87 0.38
88 0.4
89 0.35
90 0.3
91 0.23
92 0.2
93 0.14
94 0.13
95 0.11
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07
110 0.07
111 0.12
112 0.15
113 0.15
114 0.18
115 0.19
116 0.21
117 0.29
118 0.33
119 0.31
120 0.34
121 0.39
122 0.4
123 0.45
124 0.43
125 0.37
126 0.36
127 0.36
128 0.37
129 0.39
130 0.42
131 0.44
132 0.48
133 0.5
134 0.53
135 0.51
136 0.46
137 0.41
138 0.34
139 0.31
140 0.29
141 0.26
142 0.22
143 0.24
144 0.25
145 0.27
146 0.3
147 0.33
148 0.4
149 0.49
150 0.58
151 0.66
152 0.75
153 0.8
154 0.89
155 0.92
156 0.93
157 0.94
158 0.91
159 0.87
160 0.84
161 0.79
162 0.72
163 0.67
164 0.6
165 0.53
166 0.46
167 0.45
168 0.39
169 0.39
170 0.41
171 0.4
172 0.45
173 0.51
174 0.59
175 0.64