Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y2H0

Protein Details
Accession A0A6A6Y2H0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
61-82ASKKKVKETSRRRPGRKCGWRIBasic
NLS Segment(s)
PositionSequence
63-77KKKVKETSRRRPGRK
Subcellular Location(s) nucl 12, mito 6, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031127  E3_UB_ligase_RBR  
IPR002867  IBR_dom  
IPR044066  TRIAD_supradom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF01485  IBR  
PROSITE View protein in PROSITE  
PS51873  TRIAD  
CDD cd20335  BRcat_RBR  
Amino Acid Sequences WCIGPGCHSGQLHADSNPILRCAQCDFRSCVKHKVPWHDGLTCVQYDASTALRQRDMEEAASKKKVKETSRRRPGRKCGWRIEKNDGCDHMTCRKCGTQFCWLCKANYQDIWRYRNGAHRSTCRYHSTNLPDLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.24
4 0.24
5 0.21
6 0.18
7 0.15
8 0.17
9 0.2
10 0.28
11 0.28
12 0.31
13 0.35
14 0.42
15 0.5
16 0.51
17 0.56
18 0.53
19 0.57
20 0.58
21 0.63
22 0.61
23 0.6
24 0.6
25 0.53
26 0.48
27 0.44
28 0.4
29 0.3
30 0.24
31 0.17
32 0.12
33 0.11
34 0.11
35 0.1
36 0.09
37 0.11
38 0.12
39 0.14
40 0.14
41 0.15
42 0.16
43 0.15
44 0.15
45 0.17
46 0.18
47 0.2
48 0.25
49 0.25
50 0.23
51 0.27
52 0.32
53 0.34
54 0.43
55 0.5
56 0.57
57 0.67
58 0.75
59 0.78
60 0.8
61 0.83
62 0.83
63 0.82
64 0.78
65 0.78
66 0.79
67 0.8
68 0.77
69 0.77
70 0.71
71 0.65
72 0.61
73 0.53
74 0.45
75 0.38
76 0.36
77 0.35
78 0.33
79 0.3
80 0.29
81 0.31
82 0.31
83 0.33
84 0.35
85 0.36
86 0.4
87 0.44
88 0.49
89 0.47
90 0.45
91 0.47
92 0.48
93 0.43
94 0.43
95 0.42
96 0.42
97 0.48
98 0.51
99 0.47
100 0.45
101 0.42
102 0.46
103 0.47
104 0.46
105 0.47
106 0.52
107 0.58
108 0.6
109 0.63
110 0.61
111 0.59
112 0.55
113 0.57
114 0.56
115 0.56