Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NYR6

Protein Details
Accession F4NYR6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-39ETAARASLRKYKRHPHHSLLILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044917  PRIMPOL  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0005634  C:nucleus  
GO:0003682  F:chromatin binding  
GO:0003896  F:DNA primase activity  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0042276  P:error-prone translesion synthesis  
GO:0006264  P:mitochondrial DNA replication  
GO:0031297  P:replication fork processing  
GO:0009411  P:response to UV  
GO:0019985  P:translesion synthesis  
Pfam View protein in Pfam  
PF03121  Herpes_UL52  
Amino Acid Sequences MSQLTTLNSATFFGETAETAARASLRKYKRHPHHSLLILQVFPTQNDAFAFKALHPHLPLCVFPFEDDPKNPGRRKYLVSSISDFWNRYRNMTRAERHYYELIETGAPCHLYFDIEYTVSLNPSLDGNAAFKAFQNFVIERFKKICDVEYSQIRIIDLTSSTDTKFSRHLILKAPGIAFRNNYDVGQFVSYLVSDLTVLYNQFVELRQHNAHSCQSRLDLNAPSEIDANLMSAFVFEKDGVVRLFVDMGVYTRSRNFRLWKSSKLLKDTELVASPGCDIKEDEQGFRDTLVSYVETGSKLLIYTANKCNRLIANGANESSTVLSLASSDILWKSTNTGQMDYSEQSFPALERFLISAIKSINPSSKVPFIQKTMYMSELNQVWFKISNNRYCHNIGREHQSNGVYYVFDLATFVYFQRCHDPDCRHYRSKELPYPIELHPFIDTNVFMDDDTDSIADDVLIQAVESDSTQFWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.12
4 0.12
5 0.11
6 0.11
7 0.12
8 0.13
9 0.14
10 0.17
11 0.25
12 0.31
13 0.41
14 0.5
15 0.59
16 0.68
17 0.78
18 0.83
19 0.81
20 0.83
21 0.8
22 0.76
23 0.73
24 0.66
25 0.56
26 0.47
27 0.44
28 0.35
29 0.29
30 0.29
31 0.21
32 0.18
33 0.19
34 0.2
35 0.16
36 0.17
37 0.18
38 0.14
39 0.22
40 0.23
41 0.26
42 0.26
43 0.26
44 0.28
45 0.28
46 0.28
47 0.23
48 0.24
49 0.2
50 0.19
51 0.24
52 0.25
53 0.29
54 0.3
55 0.31
56 0.37
57 0.45
58 0.48
59 0.49
60 0.52
61 0.52
62 0.56
63 0.58
64 0.6
65 0.57
66 0.57
67 0.55
68 0.5
69 0.51
70 0.48
71 0.43
72 0.36
73 0.38
74 0.33
75 0.35
76 0.39
77 0.37
78 0.42
79 0.49
80 0.54
81 0.54
82 0.61
83 0.58
84 0.56
85 0.53
86 0.46
87 0.39
88 0.34
89 0.27
90 0.2
91 0.17
92 0.14
93 0.13
94 0.13
95 0.11
96 0.11
97 0.1
98 0.1
99 0.1
100 0.11
101 0.12
102 0.11
103 0.12
104 0.12
105 0.12
106 0.11
107 0.11
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.08
115 0.09
116 0.09
117 0.09
118 0.1
119 0.12
120 0.12
121 0.12
122 0.16
123 0.15
124 0.18
125 0.28
126 0.28
127 0.29
128 0.3
129 0.3
130 0.29
131 0.3
132 0.3
133 0.25
134 0.3
135 0.32
136 0.36
137 0.39
138 0.36
139 0.36
140 0.32
141 0.27
142 0.21
143 0.17
144 0.11
145 0.1
146 0.11
147 0.12
148 0.12
149 0.15
150 0.15
151 0.15
152 0.17
153 0.16
154 0.21
155 0.24
156 0.26
157 0.29
158 0.33
159 0.33
160 0.34
161 0.32
162 0.28
163 0.27
164 0.26
165 0.21
166 0.18
167 0.2
168 0.18
169 0.17
170 0.14
171 0.13
172 0.12
173 0.12
174 0.1
175 0.07
176 0.07
177 0.07
178 0.07
179 0.06
180 0.05
181 0.04
182 0.04
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.07
191 0.09
192 0.09
193 0.14
194 0.15
195 0.17
196 0.18
197 0.2
198 0.24
199 0.23
200 0.23
201 0.2
202 0.2
203 0.2
204 0.2
205 0.2
206 0.18
207 0.17
208 0.18
209 0.17
210 0.16
211 0.15
212 0.14
213 0.11
214 0.08
215 0.07
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.05
233 0.05
234 0.04
235 0.05
236 0.06
237 0.06
238 0.07
239 0.1
240 0.13
241 0.15
242 0.19
243 0.24
244 0.28
245 0.38
246 0.42
247 0.44
248 0.48
249 0.52
250 0.52
251 0.51
252 0.47
253 0.38
254 0.36
255 0.33
256 0.28
257 0.22
258 0.19
259 0.14
260 0.12
261 0.11
262 0.11
263 0.09
264 0.08
265 0.08
266 0.09
267 0.17
268 0.18
269 0.18
270 0.19
271 0.2
272 0.2
273 0.19
274 0.18
275 0.1
276 0.09
277 0.1
278 0.08
279 0.07
280 0.08
281 0.09
282 0.08
283 0.08
284 0.08
285 0.07
286 0.06
287 0.07
288 0.09
289 0.1
290 0.15
291 0.24
292 0.3
293 0.32
294 0.32
295 0.35
296 0.32
297 0.32
298 0.3
299 0.25
300 0.24
301 0.24
302 0.25
303 0.21
304 0.2
305 0.19
306 0.16
307 0.13
308 0.07
309 0.05
310 0.04
311 0.05
312 0.05
313 0.05
314 0.04
315 0.06
316 0.06
317 0.07
318 0.08
319 0.08
320 0.11
321 0.13
322 0.19
323 0.2
324 0.21
325 0.21
326 0.22
327 0.25
328 0.23
329 0.22
330 0.17
331 0.15
332 0.14
333 0.14
334 0.12
335 0.11
336 0.11
337 0.08
338 0.09
339 0.09
340 0.1
341 0.11
342 0.11
343 0.12
344 0.12
345 0.14
346 0.15
347 0.16
348 0.2
349 0.21
350 0.23
351 0.24
352 0.28
353 0.3
354 0.34
355 0.36
356 0.35
357 0.35
358 0.36
359 0.36
360 0.33
361 0.33
362 0.29
363 0.25
364 0.26
365 0.25
366 0.24
367 0.22
368 0.19
369 0.18
370 0.18
371 0.19
372 0.25
373 0.29
374 0.36
375 0.4
376 0.42
377 0.46
378 0.48
379 0.53
380 0.49
381 0.51
382 0.47
383 0.51
384 0.53
385 0.51
386 0.51
387 0.46
388 0.41
389 0.35
390 0.32
391 0.22
392 0.17
393 0.18
394 0.13
395 0.11
396 0.1
397 0.09
398 0.09
399 0.09
400 0.1
401 0.12
402 0.12
403 0.14
404 0.23
405 0.24
406 0.28
407 0.35
408 0.42
409 0.47
410 0.57
411 0.63
412 0.62
413 0.63
414 0.68
415 0.7
416 0.73
417 0.72
418 0.7
419 0.66
420 0.62
421 0.64
422 0.58
423 0.56
424 0.46
425 0.39
426 0.33
427 0.3
428 0.26
429 0.24
430 0.21
431 0.14
432 0.15
433 0.14
434 0.12
435 0.12
436 0.12
437 0.1
438 0.11
439 0.09
440 0.08
441 0.08
442 0.08
443 0.07
444 0.06
445 0.06
446 0.06
447 0.06
448 0.05
449 0.05
450 0.06
451 0.06
452 0.06
453 0.08