Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P849

Protein Details
Accession F4P849   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPKKTGKAKPQKQNEDSGDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR043323  PIN4  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF13616  Rotamase_3  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
Amino Acid Sequences MPPKKTGKAKPQKQNEDSGDVAVKGGKLKAANSIKVRHILCEKHSKIMEALELLKSGQRFDKVAEQYSEDKAKAGGSLGWMTRGSMVGVFQDAAFLLVPSTPDKPIYTNPPVKSNFGYHIIMVEDRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.71
4 0.62
5 0.54
6 0.44
7 0.33
8 0.29
9 0.21
10 0.17
11 0.13
12 0.12
13 0.12
14 0.12
15 0.12
16 0.22
17 0.26
18 0.31
19 0.34
20 0.38
21 0.38
22 0.43
23 0.43
24 0.37
25 0.38
26 0.35
27 0.35
28 0.42
29 0.41
30 0.4
31 0.41
32 0.38
33 0.33
34 0.31
35 0.27
36 0.17
37 0.17
38 0.11
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.19
49 0.19
50 0.21
51 0.21
52 0.22
53 0.23
54 0.25
55 0.25
56 0.18
57 0.16
58 0.14
59 0.14
60 0.11
61 0.09
62 0.07
63 0.07
64 0.09
65 0.09
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.09
72 0.07
73 0.07
74 0.06
75 0.06
76 0.07
77 0.06
78 0.06
79 0.05
80 0.06
81 0.05
82 0.05
83 0.04
84 0.05
85 0.06
86 0.08
87 0.1
88 0.1
89 0.12
90 0.13
91 0.16
92 0.21
93 0.28
94 0.36
95 0.42
96 0.43
97 0.5
98 0.52
99 0.53
100 0.51
101 0.47
102 0.42
103 0.39
104 0.38
105 0.3
106 0.29
107 0.27