Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4PAV7

Protein Details
Accession F4PAV7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
485-507QESRLPNKDKVSRRKTIDGSKTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
IPR033316  RBBP8-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0010792  P:DNA double-strand break processing involved in repair via single-strand annealing  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences MTTLFEQLLAGLADCHHQELQKIQTKLMDRLAVVEAENDLLRNKLNDALAMIESERNSHQQAILASGHSPRQCPNQIDHQSPANNAQHGIVHNENPLSVSANESCTSKDDLIAHLTAENTRIFRQMLQNRKSFNEQLALVSQERVGTFKQPIINDEKDAIAVYSEHDNPQYTDDTVAEPIKIAISQNAININDAGSQFIDHLVSFDLTPKKRLHSDTELAIVDSSDLTPNSPKSCSIQQPNEFDHTSPPSSIIVDECYSSNILQNFEASNMLEFFETPSKKDARFSCIAQQQLFSSPGSPIVLFHKFNESNHSFQNENMTESRQHHKQQHSVLEDSHGSIKNESDENKDQMIAKPKADSKSKMCTPVTVLGSRSINICHENNSALSKPSFAYEEVVRDKERRKQMHGEACPCCEGYYRLTADLHAPAELGAKNTPQQPVCDRIQNSSRHRFWSARPKTPPGFWRVDFPSTQENRKDNVGFDYQGQESRLPNKDKVSRRKTIDGSKTVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.14
4 0.15
5 0.17
6 0.22
7 0.32
8 0.38
9 0.38
10 0.37
11 0.41
12 0.44
13 0.47
14 0.47
15 0.4
16 0.32
17 0.34
18 0.34
19 0.29
20 0.25
21 0.21
22 0.16
23 0.14
24 0.14
25 0.11
26 0.1
27 0.1
28 0.11
29 0.12
30 0.13
31 0.16
32 0.16
33 0.16
34 0.16
35 0.18
36 0.17
37 0.17
38 0.16
39 0.14
40 0.14
41 0.16
42 0.17
43 0.18
44 0.19
45 0.2
46 0.2
47 0.21
48 0.21
49 0.23
50 0.22
51 0.2
52 0.2
53 0.2
54 0.25
55 0.23
56 0.24
57 0.23
58 0.3
59 0.36
60 0.38
61 0.41
62 0.46
63 0.51
64 0.54
65 0.54
66 0.51
67 0.47
68 0.45
69 0.48
70 0.41
71 0.36
72 0.32
73 0.3
74 0.26
75 0.25
76 0.29
77 0.24
78 0.21
79 0.22
80 0.22
81 0.21
82 0.19
83 0.18
84 0.15
85 0.13
86 0.15
87 0.14
88 0.17
89 0.17
90 0.17
91 0.18
92 0.17
93 0.21
94 0.18
95 0.19
96 0.18
97 0.19
98 0.22
99 0.21
100 0.19
101 0.16
102 0.16
103 0.14
104 0.14
105 0.14
106 0.13
107 0.13
108 0.15
109 0.15
110 0.17
111 0.27
112 0.33
113 0.42
114 0.46
115 0.5
116 0.51
117 0.53
118 0.56
119 0.48
120 0.43
121 0.37
122 0.31
123 0.28
124 0.27
125 0.27
126 0.21
127 0.2
128 0.17
129 0.14
130 0.14
131 0.13
132 0.13
133 0.13
134 0.14
135 0.17
136 0.21
137 0.2
138 0.23
139 0.29
140 0.3
141 0.27
142 0.27
143 0.23
144 0.2
145 0.19
146 0.16
147 0.09
148 0.07
149 0.08
150 0.1
151 0.11
152 0.11
153 0.12
154 0.13
155 0.13
156 0.16
157 0.16
158 0.13
159 0.13
160 0.13
161 0.13
162 0.14
163 0.14
164 0.11
165 0.1
166 0.1
167 0.09
168 0.09
169 0.08
170 0.07
171 0.08
172 0.09
173 0.11
174 0.14
175 0.14
176 0.14
177 0.14
178 0.13
179 0.13
180 0.12
181 0.11
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.11
193 0.17
194 0.17
195 0.22
196 0.22
197 0.25
198 0.29
199 0.32
200 0.33
201 0.34
202 0.36
203 0.34
204 0.36
205 0.33
206 0.28
207 0.25
208 0.18
209 0.11
210 0.09
211 0.08
212 0.05
213 0.05
214 0.05
215 0.07
216 0.09
217 0.1
218 0.11
219 0.11
220 0.14
221 0.19
222 0.25
223 0.31
224 0.37
225 0.41
226 0.45
227 0.46
228 0.47
229 0.42
230 0.36
231 0.32
232 0.27
233 0.22
234 0.18
235 0.16
236 0.13
237 0.13
238 0.12
239 0.1
240 0.09
241 0.08
242 0.09
243 0.08
244 0.08
245 0.08
246 0.08
247 0.1
248 0.1
249 0.1
250 0.1
251 0.11
252 0.1
253 0.1
254 0.1
255 0.08
256 0.07
257 0.06
258 0.07
259 0.06
260 0.05
261 0.07
262 0.12
263 0.12
264 0.13
265 0.16
266 0.18
267 0.19
268 0.25
269 0.25
270 0.26
271 0.29
272 0.3
273 0.34
274 0.36
275 0.38
276 0.33
277 0.31
278 0.25
279 0.25
280 0.24
281 0.17
282 0.13
283 0.11
284 0.11
285 0.11
286 0.1
287 0.08
288 0.12
289 0.16
290 0.16
291 0.16
292 0.23
293 0.24
294 0.24
295 0.32
296 0.3
297 0.29
298 0.3
299 0.32
300 0.25
301 0.24
302 0.32
303 0.24
304 0.24
305 0.23
306 0.22
307 0.23
308 0.26
309 0.31
310 0.29
311 0.34
312 0.39
313 0.43
314 0.48
315 0.51
316 0.55
317 0.53
318 0.49
319 0.44
320 0.39
321 0.34
322 0.29
323 0.27
324 0.22
325 0.19
326 0.18
327 0.18
328 0.17
329 0.2
330 0.2
331 0.22
332 0.24
333 0.26
334 0.26
335 0.27
336 0.26
337 0.28
338 0.36
339 0.31
340 0.28
341 0.3
342 0.34
343 0.39
344 0.42
345 0.43
346 0.39
347 0.46
348 0.49
349 0.52
350 0.48
351 0.44
352 0.42
353 0.44
354 0.43
355 0.35
356 0.32
357 0.29
358 0.29
359 0.28
360 0.25
361 0.19
362 0.17
363 0.19
364 0.19
365 0.19
366 0.19
367 0.2
368 0.21
369 0.23
370 0.22
371 0.21
372 0.2
373 0.18
374 0.17
375 0.17
376 0.17
377 0.14
378 0.16
379 0.15
380 0.21
381 0.24
382 0.27
383 0.27
384 0.31
385 0.35
386 0.41
387 0.49
388 0.48
389 0.5
390 0.56
391 0.64
392 0.7
393 0.73
394 0.73
395 0.67
396 0.64
397 0.59
398 0.5
399 0.41
400 0.32
401 0.26
402 0.21
403 0.24
404 0.23
405 0.24
406 0.24
407 0.24
408 0.25
409 0.26
410 0.23
411 0.16
412 0.15
413 0.12
414 0.15
415 0.15
416 0.15
417 0.12
418 0.14
419 0.17
420 0.21
421 0.26
422 0.24
423 0.28
424 0.31
425 0.36
426 0.38
427 0.43
428 0.41
429 0.42
430 0.48
431 0.53
432 0.57
433 0.62
434 0.61
435 0.58
436 0.62
437 0.59
438 0.6
439 0.62
440 0.63
441 0.63
442 0.66
443 0.69
444 0.69
445 0.73
446 0.71
447 0.67
448 0.65
449 0.56
450 0.57
451 0.54
452 0.54
453 0.47
454 0.45
455 0.48
456 0.45
457 0.52
458 0.51
459 0.5
460 0.48
461 0.54
462 0.51
463 0.43
464 0.43
465 0.41
466 0.34
467 0.32
468 0.34
469 0.29
470 0.31
471 0.31
472 0.28
473 0.27
474 0.34
475 0.4
476 0.41
477 0.43
478 0.49
479 0.57
480 0.64
481 0.72
482 0.73
483 0.74
484 0.76
485 0.81
486 0.8
487 0.81
488 0.81