Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0Y3W7

Protein Details
Accession A0A6H0Y3W7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
68-88TSWTVRTRPRYTHRYNREPFAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_nucl 8, nucl 6.5, mito 5, extr 5
Family & Domain DBs
Amino Acid Sequences MDSRLLDLSLTCHSLSVSLCLRNAIALARSTISITQLVLRQGQDSVDNMTPIEGIVQAEWKTHVSCSTSWTVRTRPRYTHRYNREPFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.17
5 0.17
6 0.17
7 0.18
8 0.18
9 0.16
10 0.16
11 0.12
12 0.1
13 0.09
14 0.1
15 0.09
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.08
22 0.09
23 0.1
24 0.11
25 0.12
26 0.12
27 0.11
28 0.11
29 0.11
30 0.1
31 0.09
32 0.11
33 0.1
34 0.1
35 0.09
36 0.09
37 0.08
38 0.07
39 0.07
40 0.04
41 0.04
42 0.04
43 0.07
44 0.07
45 0.08
46 0.09
47 0.1
48 0.1
49 0.11
50 0.13
51 0.13
52 0.13
53 0.17
54 0.23
55 0.24
56 0.26
57 0.3
58 0.36
59 0.42
60 0.51
61 0.52
62 0.55
63 0.62
64 0.69
65 0.74
66 0.78
67 0.8
68 0.81