Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0Y0W3

Protein Details
Accession A0A6H0Y0W3    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPAIRGSDSKKKTRRYTRDVDQIHHydrophilic
64-89TNYTAHQKGKPHKRRVKQLKEDPYTQHydrophilic
NLS Segment(s)
PositionSequence
72-78GKPHKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MPAIRGSDSKKKTRRYTRDVDQIHADLASKRHLEQYIETKAPEDLPGFGQWYCVECSKWYESETNYTAHQKGKPHKRRVKQLKEDPYTQAEAEAAAGLTTDNGRRKKDDAVMTNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.84
4 0.83
5 0.85
6 0.78
7 0.71
8 0.65
9 0.55
10 0.47
11 0.38
12 0.29
13 0.21
14 0.19
15 0.2
16 0.16
17 0.16
18 0.19
19 0.21
20 0.22
21 0.23
22 0.29
23 0.31
24 0.31
25 0.31
26 0.27
27 0.26
28 0.25
29 0.22
30 0.15
31 0.1
32 0.1
33 0.11
34 0.12
35 0.11
36 0.11
37 0.1
38 0.11
39 0.11
40 0.11
41 0.11
42 0.1
43 0.14
44 0.14
45 0.15
46 0.15
47 0.16
48 0.16
49 0.2
50 0.21
51 0.19
52 0.19
53 0.21
54 0.21
55 0.22
56 0.25
57 0.27
58 0.35
59 0.45
60 0.54
61 0.62
62 0.69
63 0.75
64 0.83
65 0.87
66 0.89
67 0.88
68 0.89
69 0.88
70 0.84
71 0.79
72 0.71
73 0.64
74 0.55
75 0.44
76 0.34
77 0.24
78 0.18
79 0.15
80 0.12
81 0.07
82 0.05
83 0.05
84 0.04
85 0.05
86 0.06
87 0.11
88 0.18
89 0.23
90 0.27
91 0.31
92 0.34
93 0.4
94 0.47
95 0.51