Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NSI3

Protein Details
Accession F4NSI3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSKHEHNRRGDKSKKSSKEPVDSHBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR044688  SCI-1-like  
Amino Acid Sequences MSKHEHNRRGDKSKKSSKEPVDSHSPKPISEEHYFQKAAEFQVWLSEKGYRFHDLSKSEAQDQFKKFIRRWNKGKLDDKYYKGIQALEVPFAARTGYKWNIKDINESEQILVHDSVESMTGSANTFNFGFRNGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.81
5 0.82
6 0.76
7 0.71
8 0.71
9 0.68
10 0.63
11 0.62
12 0.54
13 0.44
14 0.43
15 0.41
16 0.36
17 0.35
18 0.37
19 0.32
20 0.36
21 0.37
22 0.33
23 0.32
24 0.28
25 0.25
26 0.22
27 0.18
28 0.13
29 0.19
30 0.2
31 0.18
32 0.17
33 0.19
34 0.19
35 0.21
36 0.24
37 0.2
38 0.2
39 0.22
40 0.26
41 0.24
42 0.27
43 0.29
44 0.28
45 0.29
46 0.31
47 0.32
48 0.33
49 0.33
50 0.34
51 0.34
52 0.36
53 0.34
54 0.39
55 0.46
56 0.48
57 0.53
58 0.59
59 0.63
60 0.67
61 0.75
62 0.71
63 0.69
64 0.67
65 0.63
66 0.58
67 0.5
68 0.43
69 0.35
70 0.31
71 0.23
72 0.23
73 0.21
74 0.16
75 0.16
76 0.14
77 0.13
78 0.13
79 0.12
80 0.07
81 0.07
82 0.12
83 0.18
84 0.24
85 0.25
86 0.31
87 0.37
88 0.38
89 0.44
90 0.41
91 0.41
92 0.38
93 0.38
94 0.33
95 0.29
96 0.28
97 0.24
98 0.21
99 0.15
100 0.11
101 0.11
102 0.1
103 0.09
104 0.09
105 0.06
106 0.06
107 0.07
108 0.07
109 0.09
110 0.09
111 0.1
112 0.11
113 0.12
114 0.12