Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0XTB8

Protein Details
Accession A0A6H0XTB8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
469-496RMSSQVRKSKIQGRAKRRKSTLSRDELAHydrophilic
NLS Segment(s)
PositionSequence
476-487KSKIQGRAKRRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR021622  Afadin/alpha-actinin-bd  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF11559  ADIP  
Amino Acid Sequences MDSESLRTASEYLNNLLLARGLLRNGEPVDFVKPSRESRAQIINLVHDLVLRGDRDKEQREGTANAYRQLRVDEDSKKAEIERLRIKQEEVTRLHAQAQAAERMAKDDLKKVEKSMRTLQEQGVKMKTALAQVKAQCTNDIRKRDLELSRLKTHLQGQQRGNRSAIVAPSISISGSNRKPTFDTSVHNVSDPAYSLKQESNEFLTQLSQNLSDENDRLANIVRGAVLTLRELLGMQATMRGASDSGIGEDVTHNDKTLPNSFDVLASDLETTLTHLKSLLTNPNFVSIEEVEVREEEIVRMRADWEKMEQRWHDLVAMLNGWKKRMNAGEIINKDDIRKGMGLVSPNHEQTEPTISQSSAEQDSSLVDDSIAEIRHKQDADPGRISPKRKRDPLEPPESFDLRPRQQQPSRPGADQRFTASDAESEELEVPRLTIEEKLSAAAEEAAAARDDASHTTLDGAADGDTLGRMSSQVRKSKIQGRAKRRKSTLSRDELAGLLAADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.19
5 0.14
6 0.13
7 0.13
8 0.11
9 0.13
10 0.13
11 0.18
12 0.19
13 0.19
14 0.18
15 0.19
16 0.23
17 0.23
18 0.23
19 0.24
20 0.28
21 0.31
22 0.38
23 0.42
24 0.41
25 0.45
26 0.54
27 0.5
28 0.5
29 0.48
30 0.43
31 0.39
32 0.36
33 0.3
34 0.2
35 0.19
36 0.15
37 0.16
38 0.14
39 0.14
40 0.17
41 0.23
42 0.3
43 0.34
44 0.37
45 0.38
46 0.41
47 0.43
48 0.43
49 0.42
50 0.43
51 0.41
52 0.41
53 0.41
54 0.37
55 0.34
56 0.34
57 0.31
58 0.26
59 0.3
60 0.29
61 0.32
62 0.35
63 0.35
64 0.34
65 0.32
66 0.35
67 0.33
68 0.36
69 0.4
70 0.42
71 0.47
72 0.47
73 0.48
74 0.49
75 0.51
76 0.52
77 0.45
78 0.46
79 0.43
80 0.43
81 0.44
82 0.4
83 0.34
84 0.3
85 0.3
86 0.26
87 0.24
88 0.24
89 0.21
90 0.21
91 0.22
92 0.21
93 0.19
94 0.23
95 0.28
96 0.33
97 0.34
98 0.36
99 0.43
100 0.44
101 0.48
102 0.51
103 0.51
104 0.5
105 0.52
106 0.52
107 0.52
108 0.51
109 0.49
110 0.42
111 0.36
112 0.31
113 0.3
114 0.28
115 0.26
116 0.27
117 0.25
118 0.28
119 0.3
120 0.36
121 0.37
122 0.35
123 0.32
124 0.32
125 0.39
126 0.41
127 0.44
128 0.41
129 0.4
130 0.43
131 0.47
132 0.47
133 0.45
134 0.46
135 0.47
136 0.48
137 0.48
138 0.45
139 0.41
140 0.43
141 0.42
142 0.41
143 0.43
144 0.46
145 0.52
146 0.57
147 0.56
148 0.51
149 0.45
150 0.39
151 0.33
152 0.26
153 0.2
154 0.14
155 0.12
156 0.12
157 0.11
158 0.1
159 0.08
160 0.09
161 0.14
162 0.17
163 0.25
164 0.25
165 0.26
166 0.28
167 0.3
168 0.35
169 0.31
170 0.31
171 0.3
172 0.35
173 0.34
174 0.32
175 0.29
176 0.24
177 0.21
178 0.19
179 0.16
180 0.11
181 0.11
182 0.12
183 0.14
184 0.15
185 0.16
186 0.16
187 0.18
188 0.18
189 0.18
190 0.16
191 0.17
192 0.15
193 0.15
194 0.14
195 0.1
196 0.09
197 0.09
198 0.1
199 0.09
200 0.09
201 0.09
202 0.09
203 0.08
204 0.09
205 0.09
206 0.09
207 0.08
208 0.08
209 0.07
210 0.06
211 0.06
212 0.06
213 0.06
214 0.05
215 0.06
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.04
222 0.04
223 0.05
224 0.04
225 0.04
226 0.04
227 0.05
228 0.04
229 0.05
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.07
238 0.09
239 0.08
240 0.08
241 0.09
242 0.1
243 0.13
244 0.17
245 0.17
246 0.15
247 0.17
248 0.17
249 0.16
250 0.15
251 0.14
252 0.1
253 0.09
254 0.08
255 0.07
256 0.07
257 0.06
258 0.07
259 0.08
260 0.08
261 0.08
262 0.08
263 0.08
264 0.1
265 0.13
266 0.2
267 0.18
268 0.2
269 0.2
270 0.24
271 0.24
272 0.23
273 0.22
274 0.14
275 0.15
276 0.14
277 0.15
278 0.11
279 0.1
280 0.11
281 0.08
282 0.08
283 0.06
284 0.09
285 0.1
286 0.1
287 0.1
288 0.11
289 0.14
290 0.15
291 0.15
292 0.17
293 0.22
294 0.23
295 0.29
296 0.28
297 0.3
298 0.3
299 0.3
300 0.25
301 0.2
302 0.2
303 0.15
304 0.15
305 0.11
306 0.14
307 0.14
308 0.15
309 0.16
310 0.15
311 0.18
312 0.2
313 0.22
314 0.23
315 0.28
316 0.34
317 0.34
318 0.37
319 0.35
320 0.33
321 0.31
322 0.28
323 0.23
324 0.17
325 0.16
326 0.12
327 0.13
328 0.15
329 0.18
330 0.18
331 0.22
332 0.23
333 0.24
334 0.24
335 0.21
336 0.19
337 0.18
338 0.23
339 0.19
340 0.18
341 0.19
342 0.18
343 0.18
344 0.19
345 0.2
346 0.15
347 0.15
348 0.12
349 0.11
350 0.11
351 0.12
352 0.12
353 0.09
354 0.07
355 0.07
356 0.08
357 0.1
358 0.11
359 0.1
360 0.11
361 0.12
362 0.17
363 0.17
364 0.16
365 0.22
366 0.29
367 0.35
368 0.36
369 0.37
370 0.41
371 0.46
372 0.52
373 0.53
374 0.55
375 0.59
376 0.64
377 0.67
378 0.68
379 0.74
380 0.78
381 0.8
382 0.71
383 0.66
384 0.64
385 0.61
386 0.52
387 0.48
388 0.47
389 0.41
390 0.48
391 0.48
392 0.52
393 0.56
394 0.64
395 0.65
396 0.67
397 0.67
398 0.62
399 0.65
400 0.62
401 0.59
402 0.53
403 0.49
404 0.42
405 0.39
406 0.36
407 0.28
408 0.22
409 0.2
410 0.19
411 0.15
412 0.14
413 0.14
414 0.13
415 0.14
416 0.12
417 0.11
418 0.09
419 0.1
420 0.1
421 0.1
422 0.12
423 0.13
424 0.13
425 0.14
426 0.14
427 0.14
428 0.14
429 0.11
430 0.09
431 0.08
432 0.08
433 0.08
434 0.08
435 0.08
436 0.07
437 0.07
438 0.09
439 0.1
440 0.11
441 0.1
442 0.1
443 0.11
444 0.12
445 0.12
446 0.11
447 0.09
448 0.08
449 0.08
450 0.07
451 0.06
452 0.06
453 0.06
454 0.05
455 0.05
456 0.06
457 0.09
458 0.18
459 0.26
460 0.34
461 0.39
462 0.44
463 0.52
464 0.6
465 0.67
466 0.69
467 0.71
468 0.75
469 0.81
470 0.86
471 0.89
472 0.87
473 0.87
474 0.86
475 0.87
476 0.86
477 0.84
478 0.78
479 0.7
480 0.65
481 0.55
482 0.45
483 0.35