FuNGI

A0A6H0XTB8

Protein Details

Accession

A0A6H0XTB8

Localization Confidence

Medium

Confidence Score

14.3

NoLS Segment(s)

Position	Sequence	Protein Nature
469-496	RMSSQVRKSKIQGRAKRRKSTLSRDELA	Hydrophilic

NLS Segment(s)

Position	Sequence
476-487	KSKIQGRAKRRK

Subcellular Location(s)

nucl 23.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR021622 Afadin/alpha-actinin-bd
Gene Ontology	GO:0110165 C:cellular anatomical entity
Pfam	View protein in Pfam PF11559 ADIP

Amino Acid Sequences

MDSESLRTASEYLNNLLLARGLLRNGEPVDFVKPSRESRAQIINLVHDLVLRGDRDKEQREGTANAYRQLRVDEDSKKAEIERLRIKQEEVTRLHAQAQAAERMAKDDLKKVEKSMRTLQEQGVKMKTALAQVKAQCTNDIRKRDLELSRLKTHLQGQQRGNRSAIVAPSISISGSNRKPTFDTSVHNVSDPAYSLKQESNEFLTQLSQNLSDENDRLANIVRGAVLTLRELLGMQATMRGASDSGIGEDVTHNDKTLPNSFDVLASDLETTLTHLKSLLTNPNFVSIEEVEVREEEIVRMRADWEKMEQRWHDLVAMLNGWKKRMNAGEIINKDDIRKGMGLVSPNHEQTEPTISQSSAEQDSSLVDDSIAEIRHKQDADPGRISPKRKRDPLEPPESFDLRPRQQQPSRPGADQRFTASDAESEELEVPRLTIEEKLSAAAEEAAAARDDASHTTLDGAADGDTLGRMSSQVRKSKIQGRAKRRKSTLSRDELAGLLAADE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.23
2	0.23
3	0.21
4	0.19
5	0.14
6	0.13
7	0.13
8	0.11
9	0.13
10	0.13
11	0.18
12	0.19
13	0.19
14	0.18
15	0.19
16	0.23
17	0.23
18	0.23
19	0.24
20	0.28
21	0.31
22	0.38
23	0.42
24	0.41
25	0.45
26	0.54
27	0.5
28	0.5
29	0.48
30	0.43
31	0.39
32	0.36
33	0.3
34	0.2
35	0.19
36	0.15
37	0.16
38	0.14
39	0.14
40	0.17
41	0.23
42	0.3
43	0.34
44	0.37
45	0.38
46	0.41
47	0.43
48	0.43
49	0.42
50	0.43
51	0.41
52	0.41
53	0.41
54	0.37
55	0.34
56	0.34
57	0.31
58	0.26
59	0.3
60	0.29
61	0.32
62	0.35
63	0.35
64	0.34
65	0.32
66	0.35
67	0.33
68	0.36
69	0.4
70	0.42
71	0.47
72	0.47
73	0.48
74	0.49
75	0.51
76	0.52
77	0.45
78	0.46
79	0.43
80	0.43
81	0.44
82	0.4
83	0.34
84	0.3
85	0.3
86	0.26
87	0.24
88	0.24
89	0.21
90	0.21
91	0.22
92	0.21
93	0.19
94	0.23
95	0.28
96	0.33
97	0.34
98	0.36
99	0.43
100	0.44
101	0.48
102	0.51
103	0.51
104	0.5
105	0.52
106	0.52
107	0.52
108	0.51
109	0.49
110	0.42
111	0.36
112	0.31
113	0.3
114	0.28
115	0.26
116	0.27
117	0.25
118	0.28
119	0.3
120	0.36
121	0.37
122	0.35
123	0.32
124	0.32
125	0.39
126	0.41
127	0.44
128	0.41
129	0.4
130	0.43
131	0.47
132	0.47
133	0.45
134	0.46
135	0.47
136	0.48
137	0.48
138	0.45
139	0.41
140	0.43
141	0.42
142	0.41
143	0.43
144	0.46
145	0.52
146	0.57
147	0.56
148	0.51
149	0.45
150	0.39
151	0.33
152	0.26
153	0.2
154	0.14
155	0.12
156	0.12
157	0.11
158	0.1
159	0.08
160	0.09
161	0.14
162	0.17
163	0.25
164	0.25
165	0.26
166	0.28
167	0.3
168	0.35
169	0.31
170	0.31
171	0.3
172	0.35
173	0.34
174	0.32
175	0.29
176	0.24
177	0.21
178	0.19
179	0.16
180	0.11
181	0.11
182	0.12
183	0.14
184	0.15
185	0.16
186	0.16
187	0.18
188	0.18
189	0.18
190	0.16
191	0.17
192	0.15
193	0.15
194	0.14
195	0.1
196	0.09
197	0.09
198	0.1
199	0.09
200	0.09
201	0.09
202	0.09
203	0.08
204	0.09
205	0.09
206	0.09
207	0.08
208	0.08
209	0.07
210	0.06
211	0.06
212	0.06
213	0.06
214	0.05
215	0.06
216	0.05
217	0.05
218	0.05
219	0.05
220	0.05
221	0.04
222	0.04
223	0.05
224	0.04
225	0.04
226	0.04
227	0.05
228	0.04
229	0.05
230	0.06
231	0.05
232	0.05
233	0.05
234	0.05
235	0.05
236	0.05
237	0.07
238	0.09
239	0.08
240	0.08
241	0.09
242	0.1
243	0.13
244	0.17
245	0.17
246	0.15
247	0.17
248	0.17
249	0.16
250	0.15
251	0.14
252	0.1
253	0.09
254	0.08
255	0.07
256	0.07
257	0.06
258	0.07
259	0.08
260	0.08
261	0.08
262	0.08
263	0.08
264	0.1
265	0.13
266	0.2
267	0.18
268	0.2
269	0.2
270	0.24
271	0.24
272	0.23
273	0.22
274	0.14
275	0.15
276	0.14
277	0.15
278	0.11
279	0.1
280	0.11
281	0.08
282	0.08
283	0.06
284	0.09
285	0.1
286	0.1
287	0.1
288	0.11
289	0.14
290	0.15
291	0.15
292	0.17
293	0.22
294	0.23
295	0.29
296	0.28
297	0.3
298	0.3
299	0.3
300	0.25
301	0.2
302	0.2
303	0.15
304	0.15
305	0.11
306	0.14
307	0.14
308	0.15
309	0.16
310	0.15
311	0.18
312	0.2
313	0.22
314	0.23
315	0.28
316	0.34
317	0.34
318	0.37
319	0.35
320	0.33
321	0.31
322	0.28
323	0.23
324	0.17
325	0.16
326	0.12
327	0.13
328	0.15
329	0.18
330	0.18
331	0.22
332	0.23
333	0.24
334	0.24
335	0.21
336	0.19
337	0.18
338	0.23
339	0.19
340	0.18
341	0.19
342	0.18
343	0.18
344	0.19
345	0.2
346	0.15
347	0.15
348	0.12
349	0.11
350	0.11
351	0.12
352	0.12
353	0.09
354	0.07
355	0.07
356	0.08
357	0.1
358	0.11
359	0.1
360	0.11
361	0.12
362	0.17
363	0.17
364	0.16
365	0.22
366	0.29
367	0.35
368	0.36
369	0.37
370	0.41
371	0.46
372	0.52
373	0.53
374	0.55
375	0.59
376	0.64
377	0.67
378	0.68
379	0.74
380	0.78
381	0.8
382	0.71
383	0.66
384	0.64
385	0.61
386	0.52
387	0.48
388	0.47
389	0.41
390	0.48
391	0.48
392	0.52
393	0.56
394	0.64
395	0.65
396	0.67
397	0.67
398	0.62
399	0.65
400	0.62
401	0.59
402	0.53
403	0.49
404	0.42
405	0.39
406	0.36
407	0.28
408	0.22
409	0.2
410	0.19
411	0.15
412	0.14
413	0.14
414	0.13
415	0.14
416	0.12
417	0.11
418	0.09
419	0.1
420	0.1
421	0.1
422	0.12
423	0.13
424	0.13
425	0.14
426	0.14
427	0.14
428	0.14
429	0.11
430	0.09
431	0.08
432	0.08
433	0.08
434	0.08
435	0.08
436	0.07
437	0.07
438	0.09
439	0.1
440	0.11
441	0.1
442	0.1
443	0.11
444	0.12
445	0.12
446	0.11
447	0.09
448	0.08
449	0.08
450	0.07
451	0.06
452	0.06
453	0.06
454	0.05
455	0.05
456	0.06
457	0.09
458	0.18
459	0.26
460	0.34
461	0.39
462	0.44
463	0.52
464	0.6
465	0.67
466	0.69
467	0.71
468	0.75
469	0.81
470	0.86
471	0.89
472	0.87
473	0.87
474	0.86
475	0.87
476	0.86
477	0.84
478	0.78
479	0.7
480	0.65
481	0.55
482	0.45
483	0.35

A0A6H0XTB8

3D AlphaFold-predicted Structure Viewer