Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0XJ97

Protein Details
Accession A0A6H0XJ97    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-84RQPLKAPKQVRLKIRPKHRAMHSNKSIHydrophilic
NLS Segment(s)
PositionSequence
62-77KAPKQVRLKIRPKHRA
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MIYLRDTTCADLCHASTGENPASHLLFSKMHRSCKVDKFVWKDCRSVEKRATTQSVGRQPLKAPKQVRLKIRPKHRAMHSNKSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.2
5 0.2
6 0.18
7 0.18
8 0.17
9 0.17
10 0.16
11 0.15
12 0.13
13 0.14
14 0.15
15 0.24
16 0.26
17 0.31
18 0.34
19 0.38
20 0.43
21 0.47
22 0.52
23 0.47
24 0.49
25 0.51
26 0.57
27 0.62
28 0.57
29 0.51
30 0.46
31 0.52
32 0.49
33 0.48
34 0.45
35 0.42
36 0.43
37 0.46
38 0.47
39 0.39
40 0.4
41 0.41
42 0.43
43 0.42
44 0.41
45 0.38
46 0.38
47 0.46
48 0.47
49 0.48
50 0.43
51 0.45
52 0.55
53 0.59
54 0.66
55 0.67
56 0.72
57 0.73
58 0.81
59 0.83
60 0.79
61 0.82
62 0.81
63 0.81
64 0.8