Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6H0XL94

Protein Details
Accession A0A6H0XL94    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MFKIHKPFRNPNWRPPQRRNKNPRQILSEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.333, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MFKIHKPFRNPNWRPPQRRNKNPRQILSEAQRAQQSLINTQQNSGASTPQPVADGTASPVLNLNPAQGSQDLSRLVVEKNAKALNGGALSSGVTNMPSVTYSSIAAAPSLKPKKKYCDITGLPAKYKDPKSGLYYYNAEVYAVVKSLSTGQVQEYLAVRGANTVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.88
5 0.93
6 0.93
7 0.93
8 0.93
9 0.93
10 0.89
11 0.85
12 0.79
13 0.76
14 0.72
15 0.71
16 0.62
17 0.55
18 0.5
19 0.43
20 0.39
21 0.33
22 0.28
23 0.23
24 0.28
25 0.31
26 0.29
27 0.29
28 0.3
29 0.28
30 0.28
31 0.24
32 0.19
33 0.14
34 0.15
35 0.15
36 0.13
37 0.13
38 0.11
39 0.12
40 0.1
41 0.1
42 0.09
43 0.13
44 0.12
45 0.12
46 0.12
47 0.11
48 0.12
49 0.12
50 0.11
51 0.07
52 0.07
53 0.08
54 0.08
55 0.1
56 0.09
57 0.11
58 0.11
59 0.1
60 0.11
61 0.11
62 0.1
63 0.12
64 0.14
65 0.12
66 0.15
67 0.15
68 0.14
69 0.14
70 0.14
71 0.11
72 0.09
73 0.09
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.17
96 0.25
97 0.28
98 0.33
99 0.38
100 0.46
101 0.54
102 0.6
103 0.56
104 0.58
105 0.57
106 0.6
107 0.64
108 0.59
109 0.53
110 0.47
111 0.45
112 0.43
113 0.43
114 0.39
115 0.34
116 0.36
117 0.39
118 0.43
119 0.43
120 0.4
121 0.41
122 0.36
123 0.36
124 0.31
125 0.25
126 0.2
127 0.18
128 0.14
129 0.11
130 0.1
131 0.06
132 0.07
133 0.09
134 0.11
135 0.12
136 0.12
137 0.13
138 0.17
139 0.17
140 0.2
141 0.19
142 0.18
143 0.18
144 0.18
145 0.16
146 0.13