Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SVY2

Protein Details
Accession Q8SVY2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-123IIKELGPPRKAPKKNKTSQWPHydrophilic
NLS Segment(s)
PositionSequence
109-118PPRKAPKKNK
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
KEGG ecu:ECU04_0150  -  
Amino Acid Sequences MLFIGDSFDFEFITTASNPVRCALGKQFCVLLFSDNTAVYRRTAHHVCFVVPVHYPSFVRSTLKPRDLSLKESVDHLFKFKTAEDRSRFSTYVSSLTNVDFKIIKELGPPRKAPKKNKTSQWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.15
5 0.15
6 0.15
7 0.18
8 0.15
9 0.19
10 0.25
11 0.3
12 0.3
13 0.3
14 0.32
15 0.29
16 0.31
17 0.27
18 0.21
19 0.14
20 0.15
21 0.15
22 0.13
23 0.14
24 0.14
25 0.14
26 0.12
27 0.14
28 0.14
29 0.19
30 0.22
31 0.22
32 0.26
33 0.26
34 0.26
35 0.27
36 0.26
37 0.21
38 0.18
39 0.19
40 0.13
41 0.14
42 0.14
43 0.12
44 0.14
45 0.13
46 0.15
47 0.15
48 0.22
49 0.27
50 0.31
51 0.3
52 0.29
53 0.37
54 0.36
55 0.38
56 0.37
57 0.33
58 0.28
59 0.3
60 0.3
61 0.23
62 0.22
63 0.19
64 0.14
65 0.13
66 0.14
67 0.13
68 0.2
69 0.22
70 0.31
71 0.33
72 0.37
73 0.42
74 0.45
75 0.44
76 0.37
77 0.36
78 0.29
79 0.29
80 0.26
81 0.22
82 0.18
83 0.19
84 0.21
85 0.18
86 0.18
87 0.15
88 0.14
89 0.19
90 0.19
91 0.18
92 0.21
93 0.3
94 0.38
95 0.42
96 0.46
97 0.49
98 0.6
99 0.69
100 0.73
101 0.75
102 0.77
103 0.81