Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6H0XVK6

Protein Details
Accession A0A6H0XVK6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSHKTFRTKQKLAKAQKQNRPIPQWHydrophilic
39-58AKRRHWPQPFHYHNRKQDKSBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 13, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWPQPFHYHNRKQDKSVVVQPNGHVLRTIPMVKEASWQACMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.85
5 0.87
6 0.84
7 0.82
8 0.78
9 0.76
10 0.71
11 0.7
12 0.7
13 0.64
14 0.61
15 0.56
16 0.52
17 0.5
18 0.5
19 0.49
20 0.43
21 0.44
22 0.43
23 0.47
24 0.53
25 0.53
26 0.51
27 0.54
28 0.56
29 0.61
30 0.65
31 0.63
32 0.63
33 0.68
34 0.71
35 0.7
36 0.76
37 0.74
38 0.75
39 0.8
40 0.75
41 0.67
42 0.66
43 0.6
44 0.56
45 0.57
46 0.55
47 0.48
48 0.47
49 0.45
50 0.47
51 0.43
52 0.38
53 0.29
54 0.21
55 0.21
56 0.23
57 0.25
58 0.16
59 0.19
60 0.21
61 0.21
62 0.25
63 0.28
64 0.26