Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0Y649

Protein Details
Accession A0A6H0Y649    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-126QHESKLTTEKFKKRQRHFPQRNFAVKVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAAQLWGKNKDDLQKQLDELKQELVQLRTQKIAGGAQSKLNKIHDVRKSIARVLTVINASQRAQLRIFYKGKKYSPLDLRSKQTRAIRRRLTQHESKLTTEKFKKRQRHFPQRNFAVKVEYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.53
4 0.53
5 0.52
6 0.48
7 0.44
8 0.43
9 0.47
10 0.46
11 0.41
12 0.36
13 0.31
14 0.27
15 0.26
16 0.28
17 0.22
18 0.24
19 0.26
20 0.26
21 0.25
22 0.24
23 0.22
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.21
30 0.24
31 0.25
32 0.26
33 0.26
34 0.26
35 0.26
36 0.33
37 0.33
38 0.34
39 0.36
40 0.39
41 0.39
42 0.38
43 0.37
44 0.29
45 0.24
46 0.2
47 0.2
48 0.14
49 0.13
50 0.11
51 0.11
52 0.11
53 0.14
54 0.14
55 0.14
56 0.14
57 0.17
58 0.17
59 0.24
60 0.28
61 0.28
62 0.34
63 0.38
64 0.39
65 0.44
66 0.45
67 0.46
68 0.51
69 0.55
70 0.56
71 0.56
72 0.61
73 0.6
74 0.58
75 0.57
76 0.56
77 0.58
78 0.57
79 0.62
80 0.64
81 0.64
82 0.71
83 0.74
84 0.74
85 0.73
86 0.74
87 0.73
88 0.67
89 0.64
90 0.63
91 0.57
92 0.59
93 0.59
94 0.6
95 0.61
96 0.67
97 0.74
98 0.76
99 0.84
100 0.86
101 0.89
102 0.9
103 0.91
104 0.92
105 0.92
106 0.91
107 0.85
108 0.75