Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6H0XX41

Protein Details
Accession A0A6H0XX41    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24NTSLHASRRKSRKAHFSAPSHydrophilic
NLS Segment(s)
PositionSequence
14-14K
130-133KKRA
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MAKVNTSLHASRRKSRKAHFSAPSSERRTIMSAPLSKELREKHNVRAIPIRKDDEVIIKRGSNKGREGKVTSVYRLKYVIHVERVSREKSNGQSVPIGIAPSKVEITKLKLDKDREQILERVGQGREANKKRASKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.77
4 0.76
5 0.8
6 0.79
7 0.75
8 0.75
9 0.72
10 0.72
11 0.67
12 0.61
13 0.52
14 0.46
15 0.44
16 0.36
17 0.35
18 0.33
19 0.31
20 0.31
21 0.37
22 0.36
23 0.33
24 0.37
25 0.36
26 0.35
27 0.39
28 0.39
29 0.4
30 0.46
31 0.46
32 0.44
33 0.5
34 0.49
35 0.47
36 0.49
37 0.45
38 0.38
39 0.38
40 0.36
41 0.35
42 0.32
43 0.28
44 0.25
45 0.23
46 0.25
47 0.29
48 0.31
49 0.26
50 0.3
51 0.34
52 0.34
53 0.36
54 0.37
55 0.34
56 0.38
57 0.36
58 0.32
59 0.31
60 0.29
61 0.26
62 0.25
63 0.23
64 0.19
65 0.23
66 0.24
67 0.24
68 0.25
69 0.25
70 0.29
71 0.32
72 0.32
73 0.28
74 0.27
75 0.27
76 0.29
77 0.36
78 0.32
79 0.3
80 0.28
81 0.27
82 0.27
83 0.23
84 0.2
85 0.12
86 0.12
87 0.1
88 0.1
89 0.11
90 0.1
91 0.12
92 0.13
93 0.18
94 0.26
95 0.29
96 0.34
97 0.39
98 0.45
99 0.5
100 0.56
101 0.57
102 0.53
103 0.53
104 0.5
105 0.46
106 0.45
107 0.39
108 0.36
109 0.29
110 0.29
111 0.28
112 0.32
113 0.4
114 0.41
115 0.48
116 0.51