Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6H0Y5P5

Protein Details
Accession A0A6H0Y5P5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
166-200FENKESAKEAKKREKEKERDKDKDKEKEKDKESRSBasic
NLS Segment(s)
PositionSequence
172-210AKEAKKREKEKERDKDKDKEKEKDKESRSSLRRSILKSR
Subcellular Location(s) plas 17, extr 2, pero 2, E.R. 2, nucl 1, mito 1, golg 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDILAIHALGTASWLTIQALPLLFAPSLITTLLSQDPHRITDLETYLCRSLGLILISVALLQFLLTGLVPLRVGQRVAFTSLNDSVTAAKSPYQRASLTIITIYFALAAFYAYTQVTVSFSFAFAIGLVGDTALFALGLWVLLFGNEKSSISKSTGADKRTSNYPFENKESAKEAKKREKEKERDKDKDKEKEKDKESRSSLRRSILKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.1
5 0.11
6 0.11
7 0.11
8 0.12
9 0.13
10 0.12
11 0.1
12 0.11
13 0.09
14 0.09
15 0.09
16 0.09
17 0.07
18 0.1
19 0.13
20 0.14
21 0.14
22 0.19
23 0.21
24 0.21
25 0.23
26 0.21
27 0.2
28 0.24
29 0.25
30 0.23
31 0.22
32 0.24
33 0.23
34 0.22
35 0.21
36 0.15
37 0.13
38 0.12
39 0.12
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.06
46 0.04
47 0.03
48 0.03
49 0.03
50 0.02
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.05
57 0.05
58 0.07
59 0.08
60 0.08
61 0.08
62 0.1
63 0.11
64 0.14
65 0.14
66 0.13
67 0.15
68 0.16
69 0.16
70 0.14
71 0.14
72 0.11
73 0.11
74 0.12
75 0.09
76 0.11
77 0.13
78 0.15
79 0.17
80 0.18
81 0.18
82 0.19
83 0.23
84 0.2
85 0.18
86 0.16
87 0.14
88 0.11
89 0.11
90 0.09
91 0.05
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.06
133 0.07
134 0.08
135 0.09
136 0.11
137 0.13
138 0.15
139 0.19
140 0.18
141 0.27
142 0.32
143 0.33
144 0.35
145 0.35
146 0.36
147 0.39
148 0.41
149 0.35
150 0.37
151 0.42
152 0.43
153 0.46
154 0.5
155 0.43
156 0.44
157 0.45
158 0.45
159 0.46
160 0.49
161 0.53
162 0.57
163 0.65
164 0.71
165 0.76
166 0.81
167 0.83
168 0.87
169 0.89
170 0.88
171 0.9
172 0.88
173 0.88
174 0.87
175 0.86
176 0.84
177 0.83
178 0.82
179 0.82
180 0.82
181 0.82
182 0.78
183 0.77
184 0.76
185 0.76
186 0.73
187 0.72
188 0.71
189 0.69
190 0.71