Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0XVH4

Protein Details
Accession A0A6H0XVH4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNVPKTRKTYCKGKDCKKHTMHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKDCKKHTMHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTQCKTKAQLALKRCKHFELVVTRRPRSCSCLLSVLINIMAYGTDGICSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.82
4 0.87
5 0.85
6 0.85
7 0.85
8 0.85
9 0.82
10 0.82
11 0.84
12 0.77
13 0.77
14 0.71
15 0.63
16 0.56
17 0.51
18 0.41
19 0.33
20 0.32
21 0.32
22 0.31
23 0.31
24 0.36
25 0.39
26 0.44
27 0.5
28 0.54
29 0.51
30 0.57
31 0.65
32 0.62
33 0.64
34 0.62
35 0.61
36 0.6
37 0.62
38 0.53
39 0.48
40 0.44
41 0.36
42 0.38
43 0.39
44 0.37
45 0.31
46 0.38
47 0.41
48 0.49
49 0.57
50 0.59
51 0.58
52 0.61
53 0.68
54 0.69
55 0.67
56 0.62
57 0.59
58 0.58
59 0.59
60 0.56
61 0.51
62 0.48
63 0.44
64 0.4
65 0.37
66 0.35
67 0.35
68 0.39
69 0.43
70 0.46
71 0.55
72 0.61
73 0.63
74 0.61
75 0.55
76 0.5
77 0.45
78 0.44
79 0.44
80 0.44
81 0.47
82 0.52
83 0.54
84 0.53
85 0.57
86 0.53
87 0.49
88 0.47
89 0.42
90 0.39
91 0.41
92 0.39
93 0.36
94 0.34
95 0.29
96 0.23
97 0.2
98 0.15
99 0.1
100 0.08
101 0.07
102 0.07
103 0.05