Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P3P6

Protein Details
Accession F4P3P6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
6-34IPKTRNTFCKGQKCRKHTPHKVTQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVIVNIPKTRNTFCKGQKCRKHTPHKVTQYKTGKASLFAQGKRRYDAKQSGYGGQTKPVFHKKAKTTKKVVLRLECSVCKHKQQVSLKRCKHFELGGDKKTKGAALSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.73
4 0.78
5 0.79
6 0.86
7 0.87
8 0.88
9 0.88
10 0.88
11 0.88
12 0.89
13 0.9
14 0.83
15 0.83
16 0.8
17 0.74
18 0.67
19 0.61
20 0.5
21 0.43
22 0.41
23 0.39
24 0.37
25 0.35
26 0.41
27 0.42
28 0.43
29 0.44
30 0.45
31 0.39
32 0.39
33 0.44
34 0.4
35 0.4
36 0.4
37 0.4
38 0.39
39 0.4
40 0.33
41 0.29
42 0.27
43 0.21
44 0.24
45 0.29
46 0.31
47 0.29
48 0.37
49 0.41
50 0.5
51 0.59
52 0.62
53 0.61
54 0.65
55 0.72
56 0.72
57 0.71
58 0.67
59 0.62
60 0.6
61 0.58
62 0.54
63 0.49
64 0.48
65 0.43
66 0.42
67 0.44
68 0.43
69 0.48
70 0.55
71 0.61
72 0.65
73 0.73
74 0.75
75 0.77
76 0.75
77 0.7
78 0.64
79 0.57
80 0.54
81 0.54
82 0.55
83 0.55
84 0.57
85 0.54
86 0.5
87 0.48
88 0.42