Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6H0XP30

Protein Details
Accession A0A6H0XP30    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-40GLKLKGVKDGRVKKHKKKKPAADMLEDABasic
NLS Segment(s)
PositionSequence
15-32KLKGVKDGRVKKHKKKKP
91-92RK
97-105RARREGAKS
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPLSDYTDSVGGGLKLKGVKDGRVKKHKKKKPAADMLEDAGDKPSTSEHHDSHANEEIESAKATAASTDVARSANKYGKTEAQLQHEERRRKMEDDRARREGAKSHKEKVEELNKYLSKLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.22
5 0.22
6 0.28
7 0.36
8 0.46
9 0.53
10 0.62
11 0.72
12 0.76
13 0.85
14 0.87
15 0.88
16 0.89
17 0.89
18 0.89
19 0.9
20 0.85
21 0.8
22 0.74
23 0.65
24 0.56
25 0.45
26 0.34
27 0.25
28 0.19
29 0.12
30 0.1
31 0.09
32 0.09
33 0.15
34 0.19
35 0.18
36 0.21
37 0.26
38 0.26
39 0.28
40 0.33
41 0.28
42 0.23
43 0.23
44 0.21
45 0.17
46 0.16
47 0.13
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.08
60 0.11
61 0.14
62 0.16
63 0.18
64 0.19
65 0.22
66 0.25
67 0.31
68 0.32
69 0.34
70 0.37
71 0.39
72 0.45
73 0.49
74 0.52
75 0.47
76 0.5
77 0.47
78 0.45
79 0.49
80 0.51
81 0.54
82 0.59
83 0.65
84 0.63
85 0.62
86 0.6
87 0.56
88 0.52
89 0.52
90 0.52
91 0.49
92 0.51
93 0.53
94 0.53
95 0.54
96 0.56
97 0.57
98 0.51
99 0.49
100 0.51
101 0.48
102 0.47
103 0.46
104 0.38
105 0.31
106 0.28
107 0.3
108 0.3
109 0.31
110 0.35
111 0.4
112 0.4