Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6H0XNS3

Protein Details
Accession A0A6H0XNS3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPATGGKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPATGGKKQKKKWSKGKVKDKAQHAVIMDKATNEKLQKDVQSYRLISVAVLVDRLKINGSLARRALKDLEERGQIKKVVSHNACSIYTRAVAGSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.9
4 0.93
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.48
14 0.39
15 0.34
16 0.27
17 0.2
18 0.19
19 0.17
20 0.18
21 0.16
22 0.16
23 0.17
24 0.2
25 0.21
26 0.24
27 0.26
28 0.27
29 0.3
30 0.3
31 0.28
32 0.25
33 0.23
34 0.17
35 0.15
36 0.12
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.07
46 0.1
47 0.12
48 0.15
49 0.17
50 0.21
51 0.21
52 0.22
53 0.23
54 0.23
55 0.26
56 0.26
57 0.28
58 0.31
59 0.32
60 0.33
61 0.36
62 0.35
63 0.3
64 0.32
65 0.32
66 0.36
67 0.36
68 0.38
69 0.38
70 0.41
71 0.41
72 0.37
73 0.35
74 0.27
75 0.25
76 0.22
77 0.18