Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UUA5

Protein Details
Accession A0A642UUA5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
62-88GMYTLRPRYKWEQKKRRERLAARANPIHydrophilic
NLS Segment(s)
PositionSequence
68-80PRYKWEQKKRRER
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR040450  TFIIF_beta_HTH  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
Amino Acid Sequences MKRRGRVLMEPEELKGKLRMLFDQRDHWSLHGLASSIGQPEQHVSWTLRKMAIKEKEAPNKGMYTLRPRYKWEQKKRRERLAARANPINQPSDFERSDEEMMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.25
4 0.23
5 0.24
6 0.28
7 0.3
8 0.37
9 0.38
10 0.43
11 0.45
12 0.43
13 0.42
14 0.37
15 0.33
16 0.26
17 0.24
18 0.17
19 0.13
20 0.11
21 0.11
22 0.11
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.08
30 0.1
31 0.11
32 0.15
33 0.16
34 0.18
35 0.19
36 0.19
37 0.21
38 0.27
39 0.31
40 0.3
41 0.35
42 0.41
43 0.47
44 0.48
45 0.48
46 0.41
47 0.36
48 0.35
49 0.32
50 0.27
51 0.27
52 0.33
53 0.37
54 0.38
55 0.43
56 0.5
57 0.58
58 0.66
59 0.69
60 0.72
61 0.76
62 0.85
63 0.89
64 0.91
65 0.9
66 0.85
67 0.84
68 0.85
69 0.82
70 0.78
71 0.76
72 0.68
73 0.63
74 0.6
75 0.52
76 0.41
77 0.37
78 0.35
79 0.35
80 0.33
81 0.28
82 0.3
83 0.31