Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P9W5

Protein Details
Accession F4P9W5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-58LATPKKRTTHRTKRIKLAPKWHydrophilic
NLS Segment(s)
PositionSequence
42-58KKRTTHRTKRIKLAPKW
Subcellular Location(s) mito 18.5, cyto_mito 10, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAGVLLSSFTIQSVLSPLVQRLLPQALLGWDFLGGFLLATPKKRTTHRTKRIKLAPKWLKPMKNIQQCPICGADKLIHHICPKCLKTLKQAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.12
5 0.14
6 0.14
7 0.14
8 0.14
9 0.15
10 0.13
11 0.12
12 0.13
13 0.11
14 0.12
15 0.12
16 0.09
17 0.06
18 0.06
19 0.06
20 0.06
21 0.04
22 0.03
23 0.03
24 0.06
25 0.07
26 0.09
27 0.12
28 0.15
29 0.19
30 0.23
31 0.31
32 0.39
33 0.5
34 0.58
35 0.67
36 0.69
37 0.75
38 0.81
39 0.83
40 0.76
41 0.76
42 0.76
43 0.71
44 0.75
45 0.72
46 0.67
47 0.61
48 0.67
49 0.66
50 0.66
51 0.63
52 0.6
53 0.6
54 0.56
55 0.55
56 0.48
57 0.39
58 0.29
59 0.28
60 0.25
61 0.21
62 0.27
63 0.27
64 0.27
65 0.31
66 0.34
67 0.37
68 0.43
69 0.43
70 0.45
71 0.5
72 0.5