Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642ULA7

Protein Details
Accession A0A642ULA7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
566-591EKLDKEIERDSRRKRRHNLNEDHLASBasic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 8, cyto 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0070603  C:SWI/SNF superfamily-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MNFNQGNMMSQGSMGQPPYGGGGQPSQPPPQGMRQFPTTALAQMTPQQLQQLKNHPQYQEIIRQYAHRQMMLQQQQQQHQQQPPQQPPQPMQAPMGQPTPAMMAQRQHSGAMPRQPGPMAAAQLAARQGMGVAPGGVPQPHPAAVGAGQLPPGVAPGAAPPAMALAAGGGGIDPTTGRRVTAAVPAVPGAIAAAAAAAAVTQPPPPPPIEANAIQVPPIINPDQYSRPVLASLKSNKMDDAHYWSKQLEKEGKPVPSDVKLYENIVDADSKYLKQYKEQLRGSKQLLADLQRDSVSYNEIKQLRVNAITLSSKHTFNNSIWGEGYQGYGNGITNAPTKLVLPGKDITDRQINERVLKQRQSGEKPHFVPIRLEFDFERDKFKLRDTFLWDLNEEVITVESFVHQLIDDYKFVSAENYSTILASVKEQIAEYTKIPERTSGELRVPIKVNVVINDTQLVDKFEWDILNCHDGDAEEFATQLCDEMGLPGEFATAVSHIIREQTQMYHKALSFTGYSFDGAPIQEEETRSHLLPQLKTGDDFYTVLRNSQAVIEYGPSVQKLSQQEVEKLDKEIERDSRRKRRHNLNEDHLASLAGASGAASNRGPSSRRMAFHSGRGGPALPDLSDVPKTFRTPAPSSVLPGAADVGVPRVYDYAEVSAFKTQVRNPDYRPPLAADAVRYHWDANHGTFMVKLKFRRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.13
5 0.16
6 0.15
7 0.14
8 0.13
9 0.16
10 0.19
11 0.25
12 0.29
13 0.3
14 0.31
15 0.34
16 0.36
17 0.43
18 0.48
19 0.46
20 0.47
21 0.48
22 0.48
23 0.46
24 0.46
25 0.37
26 0.31
27 0.27
28 0.23
29 0.19
30 0.23
31 0.26
32 0.24
33 0.23
34 0.27
35 0.3
36 0.33
37 0.39
38 0.43
39 0.5
40 0.57
41 0.62
42 0.56
43 0.55
44 0.56
45 0.56
46 0.55
47 0.49
48 0.44
49 0.4
50 0.43
51 0.44
52 0.47
53 0.43
54 0.35
55 0.32
56 0.34
57 0.43
58 0.48
59 0.5
60 0.49
61 0.52
62 0.57
63 0.64
64 0.65
65 0.63
66 0.61
67 0.63
68 0.64
69 0.67
70 0.7
71 0.71
72 0.7
73 0.68
74 0.64
75 0.65
76 0.62
77 0.55
78 0.49
79 0.45
80 0.42
81 0.4
82 0.39
83 0.3
84 0.25
85 0.23
86 0.24
87 0.19
88 0.18
89 0.17
90 0.2
91 0.22
92 0.27
93 0.27
94 0.25
95 0.26
96 0.29
97 0.33
98 0.36
99 0.38
100 0.35
101 0.37
102 0.36
103 0.34
104 0.32
105 0.28
106 0.22
107 0.18
108 0.18
109 0.16
110 0.17
111 0.17
112 0.14
113 0.11
114 0.09
115 0.08
116 0.07
117 0.07
118 0.06
119 0.05
120 0.05
121 0.07
122 0.08
123 0.08
124 0.09
125 0.1
126 0.12
127 0.12
128 0.12
129 0.11
130 0.12
131 0.12
132 0.14
133 0.13
134 0.11
135 0.11
136 0.1
137 0.1
138 0.08
139 0.08
140 0.06
141 0.05
142 0.04
143 0.05
144 0.08
145 0.08
146 0.08
147 0.07
148 0.08
149 0.08
150 0.07
151 0.06
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.07
163 0.08
164 0.08
165 0.08
166 0.1
167 0.12
168 0.17
169 0.19
170 0.16
171 0.17
172 0.17
173 0.16
174 0.15
175 0.13
176 0.07
177 0.04
178 0.03
179 0.03
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.03
188 0.05
189 0.06
190 0.07
191 0.1
192 0.11
193 0.13
194 0.14
195 0.17
196 0.21
197 0.21
198 0.24
199 0.25
200 0.24
201 0.21
202 0.21
203 0.18
204 0.13
205 0.15
206 0.13
207 0.1
208 0.11
209 0.15
210 0.18
211 0.2
212 0.21
213 0.19
214 0.18
215 0.2
216 0.2
217 0.18
218 0.22
219 0.25
220 0.3
221 0.31
222 0.31
223 0.3
224 0.3
225 0.3
226 0.25
227 0.28
228 0.27
229 0.26
230 0.27
231 0.26
232 0.29
233 0.28
234 0.33
235 0.33
236 0.29
237 0.36
238 0.4
239 0.42
240 0.39
241 0.4
242 0.36
243 0.3
244 0.3
245 0.24
246 0.22
247 0.2
248 0.21
249 0.2
250 0.18
251 0.15
252 0.14
253 0.13
254 0.1
255 0.11
256 0.11
257 0.1
258 0.12
259 0.16
260 0.16
261 0.19
262 0.28
263 0.35
264 0.44
265 0.49
266 0.54
267 0.55
268 0.6
269 0.59
270 0.54
271 0.45
272 0.38
273 0.35
274 0.3
275 0.27
276 0.22
277 0.21
278 0.17
279 0.17
280 0.14
281 0.12
282 0.12
283 0.1
284 0.11
285 0.16
286 0.17
287 0.17
288 0.18
289 0.2
290 0.19
291 0.19
292 0.18
293 0.12
294 0.13
295 0.14
296 0.14
297 0.17
298 0.17
299 0.17
300 0.17
301 0.19
302 0.19
303 0.18
304 0.26
305 0.21
306 0.2
307 0.19
308 0.19
309 0.18
310 0.16
311 0.17
312 0.08
313 0.07
314 0.06
315 0.06
316 0.06
317 0.06
318 0.06
319 0.06
320 0.08
321 0.08
322 0.08
323 0.08
324 0.08
325 0.1
326 0.13
327 0.12
328 0.14
329 0.15
330 0.16
331 0.19
332 0.19
333 0.18
334 0.21
335 0.21
336 0.21
337 0.27
338 0.26
339 0.26
340 0.3
341 0.34
342 0.33
343 0.36
344 0.35
345 0.34
346 0.4
347 0.43
348 0.46
349 0.46
350 0.48
351 0.47
352 0.51
353 0.47
354 0.42
355 0.39
356 0.34
357 0.34
358 0.27
359 0.27
360 0.21
361 0.22
362 0.27
363 0.25
364 0.27
365 0.21
366 0.24
367 0.24
368 0.28
369 0.3
370 0.27
371 0.31
372 0.32
373 0.35
374 0.35
375 0.36
376 0.32
377 0.27
378 0.24
379 0.19
380 0.13
381 0.09
382 0.06
383 0.05
384 0.05
385 0.04
386 0.04
387 0.05
388 0.04
389 0.04
390 0.04
391 0.05
392 0.07
393 0.09
394 0.09
395 0.09
396 0.09
397 0.09
398 0.09
399 0.1
400 0.07
401 0.06
402 0.07
403 0.08
404 0.08
405 0.07
406 0.08
407 0.08
408 0.08
409 0.08
410 0.09
411 0.08
412 0.09
413 0.09
414 0.09
415 0.12
416 0.13
417 0.13
418 0.16
419 0.19
420 0.2
421 0.21
422 0.23
423 0.23
424 0.26
425 0.29
426 0.27
427 0.26
428 0.3
429 0.3
430 0.31
431 0.3
432 0.25
433 0.24
434 0.23
435 0.22
436 0.17
437 0.2
438 0.17
439 0.16
440 0.17
441 0.15
442 0.13
443 0.13
444 0.13
445 0.1
446 0.1
447 0.1
448 0.1
449 0.1
450 0.11
451 0.12
452 0.12
453 0.14
454 0.14
455 0.13
456 0.12
457 0.11
458 0.11
459 0.11
460 0.1
461 0.07
462 0.07
463 0.07
464 0.07
465 0.07
466 0.06
467 0.05
468 0.04
469 0.04
470 0.05
471 0.07
472 0.06
473 0.06
474 0.06
475 0.06
476 0.06
477 0.06
478 0.06
479 0.04
480 0.05
481 0.05
482 0.06
483 0.06
484 0.08
485 0.08
486 0.1
487 0.11
488 0.13
489 0.18
490 0.22
491 0.24
492 0.26
493 0.26
494 0.26
495 0.25
496 0.23
497 0.19
498 0.15
499 0.16
500 0.13
501 0.13
502 0.12
503 0.12
504 0.11
505 0.1
506 0.11
507 0.1
508 0.11
509 0.13
510 0.14
511 0.15
512 0.17
513 0.2
514 0.18
515 0.19
516 0.22
517 0.26
518 0.26
519 0.29
520 0.3
521 0.28
522 0.29
523 0.29
524 0.25
525 0.21
526 0.21
527 0.18
528 0.2
529 0.19
530 0.19
531 0.18
532 0.17
533 0.16
534 0.16
535 0.16
536 0.1
537 0.11
538 0.11
539 0.11
540 0.12
541 0.12
542 0.11
543 0.11
544 0.11
545 0.16
546 0.18
547 0.22
548 0.28
549 0.3
550 0.34
551 0.38
552 0.43
553 0.38
554 0.36
555 0.35
556 0.31
557 0.3
558 0.31
559 0.35
560 0.39
561 0.46
562 0.55
563 0.62
564 0.71
565 0.79
566 0.83
567 0.85
568 0.88
569 0.9
570 0.9
571 0.88
572 0.88
573 0.79
574 0.71
575 0.6
576 0.48
577 0.37
578 0.27
579 0.18
580 0.08
581 0.05
582 0.04
583 0.06
584 0.06
585 0.08
586 0.08
587 0.09
588 0.1
589 0.14
590 0.15
591 0.17
592 0.25
593 0.3
594 0.32
595 0.38
596 0.45
597 0.46
598 0.51
599 0.56
600 0.5
601 0.44
602 0.44
603 0.38
604 0.3
605 0.29
606 0.24
607 0.15
608 0.15
609 0.15
610 0.17
611 0.2
612 0.2
613 0.21
614 0.24
615 0.27
616 0.29
617 0.31
618 0.36
619 0.37
620 0.41
621 0.44
622 0.41
623 0.43
624 0.41
625 0.39
626 0.31
627 0.27
628 0.23
629 0.15
630 0.14
631 0.11
632 0.11
633 0.1
634 0.1
635 0.1
636 0.09
637 0.1
638 0.11
639 0.12
640 0.13
641 0.14
642 0.15
643 0.17
644 0.2
645 0.2
646 0.21
647 0.24
648 0.24
649 0.32
650 0.37
651 0.41
652 0.42
653 0.52
654 0.57
655 0.55
656 0.55
657 0.49
658 0.48
659 0.46
660 0.43
661 0.37
662 0.34
663 0.35
664 0.36
665 0.32
666 0.29
667 0.26
668 0.29
669 0.28
670 0.26
671 0.28
672 0.26
673 0.25
674 0.27
675 0.31
676 0.33
677 0.35
678 0.36