Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642UVA6

Protein Details
Accession A0A642UVA6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
160-182ETYAQMRKTSKNKISQRSKALAKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 10, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002637  Ham1p-like  
IPR027502  ITPase  
IPR029001  ITPase-like_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0047429  F:nucleoside triphosphate diphosphatase activity  
GO:0000166  F:nucleotide binding  
GO:0009204  P:deoxyribonucleoside triphosphate catabolic process  
GO:0009117  P:nucleotide metabolic process  
Pfam View protein in Pfam  
PF01725  Ham1p_like  
Amino Acid Sequences MSKTLTFVTGNSNKLKEFQAILGGDDGKVGDWKLTNQSVDLDELQGTIEEVTIHKAKQAAERIKGPVVIEDTCLGFNAMNNLPGPYIKWFVKSIGLAGLVDMLYKFDDKSANAITTVGFCEGPGHEVKLFQGVTTGVIVDSRGPTDFGWDSIFQPDGFEETYAQMRKTSKNKISQRSKALAKLREFLESN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.3
4 0.27
5 0.24
6 0.26
7 0.24
8 0.24
9 0.24
10 0.22
11 0.19
12 0.17
13 0.15
14 0.09
15 0.1
16 0.09
17 0.08
18 0.09
19 0.11
20 0.17
21 0.2
22 0.2
23 0.19
24 0.21
25 0.2
26 0.22
27 0.2
28 0.15
29 0.12
30 0.12
31 0.11
32 0.09
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.09
39 0.1
40 0.1
41 0.11
42 0.14
43 0.15
44 0.21
45 0.3
46 0.32
47 0.35
48 0.38
49 0.39
50 0.38
51 0.38
52 0.31
53 0.24
54 0.21
55 0.17
56 0.15
57 0.13
58 0.13
59 0.11
60 0.11
61 0.09
62 0.07
63 0.06
64 0.1
65 0.09
66 0.1
67 0.1
68 0.1
69 0.1
70 0.1
71 0.11
72 0.09
73 0.12
74 0.11
75 0.13
76 0.14
77 0.15
78 0.17
79 0.16
80 0.14
81 0.11
82 0.11
83 0.09
84 0.08
85 0.08
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.07
95 0.07
96 0.1
97 0.12
98 0.12
99 0.12
100 0.12
101 0.11
102 0.1
103 0.11
104 0.09
105 0.07
106 0.06
107 0.07
108 0.07
109 0.09
110 0.09
111 0.1
112 0.1
113 0.1
114 0.1
115 0.14
116 0.14
117 0.11
118 0.12
119 0.1
120 0.11
121 0.1
122 0.1
123 0.06
124 0.06
125 0.06
126 0.06
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.13
133 0.13
134 0.13
135 0.16
136 0.16
137 0.16
138 0.17
139 0.19
140 0.14
141 0.14
142 0.13
143 0.12
144 0.12
145 0.12
146 0.1
147 0.11
148 0.18
149 0.19
150 0.19
151 0.21
152 0.24
153 0.31
154 0.38
155 0.47
156 0.49
157 0.58
158 0.67
159 0.74
160 0.81
161 0.82
162 0.83
163 0.81
164 0.78
165 0.77
166 0.76
167 0.73
168 0.67
169 0.64
170 0.57