Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A642UD47

Protein Details
Accession A0A642UD47    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-42ALAGGKKGKKKWNKGKVKDKAQHLVBasic
NLS Segment(s)
PositionSequence
20-36AGGKKGKKKWNKGKVKD
Subcellular Location(s) cyto_mito 12.833, mito 12.5, cyto 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKIQQTKAAKVLAAAALAGGKKGKKKWNKGKVKDKAQHLVVLDQEKYDRIMKEVPTFKFVSVSVLVDRLKIGGSMARVALRQLEDEGIITPVVKSSKQVVYTRAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.17
4 0.1
5 0.1
6 0.1
7 0.1
8 0.1
9 0.11
10 0.16
11 0.23
12 0.32
13 0.41
14 0.52
15 0.63
16 0.71
17 0.8
18 0.85
19 0.9
20 0.9
21 0.91
22 0.87
23 0.82
24 0.78
25 0.69
26 0.62
27 0.51
28 0.43
29 0.35
30 0.31
31 0.24
32 0.17
33 0.16
34 0.13
35 0.14
36 0.15
37 0.12
38 0.12
39 0.15
40 0.16
41 0.22
42 0.28
43 0.27
44 0.28
45 0.28
46 0.26
47 0.25
48 0.23
49 0.2
50 0.14
51 0.15
52 0.11
53 0.14
54 0.14
55 0.12
56 0.12
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.08
63 0.09
64 0.1
65 0.1
66 0.1
67 0.11
68 0.13
69 0.12
70 0.12
71 0.12
72 0.11
73 0.11
74 0.11
75 0.12
76 0.1
77 0.09
78 0.08
79 0.07
80 0.09
81 0.11
82 0.11
83 0.12
84 0.17
85 0.23
86 0.29
87 0.33