Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A642V0A8

Protein Details
Accession A0A642V0A8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSNRRAQKYRERQELRQQIEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11, cyto 8, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021463  Methyltransf_34  
Pfam View protein in Pfam  
PF11312  Methyltransf_34  
Amino Acid Sequences MSNRRAQKYRERQELRQQIEEEEEAEVPSVTSSNEHLPFASEECIEPEKVIEMFKTCLADILESEDLQDVIQEVKGDLYRRDYLVAFDDDEKRYAYASRWTPSRAIAYASLFGSLEQITELFKSNDGQRKALCVGGGAAGELVGLGAVYARQKQLNPQCPALSVDLVDIANWKNVVASLYNNMSSWFYDPSQFTTKFMKNDILSSSISFSDYDLITVLFTTNELFTEKRKETIGFLSRLSAQCKPGSLLLMAESAGSYSHIEVGSKKFPVQMLIDMVLLGKKGEDNGAWEVVDQSESCWYRVRGELNYPMKLENMRFFYRLYKHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.81
3 0.78
4 0.69
5 0.59
6 0.56
7 0.49
8 0.39
9 0.3
10 0.24
11 0.17
12 0.16
13 0.14
14 0.09
15 0.09
16 0.08
17 0.07
18 0.07
19 0.1
20 0.16
21 0.18
22 0.18
23 0.18
24 0.2
25 0.21
26 0.22
27 0.22
28 0.16
29 0.14
30 0.18
31 0.2
32 0.18
33 0.16
34 0.15
35 0.15
36 0.15
37 0.16
38 0.13
39 0.13
40 0.14
41 0.16
42 0.17
43 0.15
44 0.17
45 0.16
46 0.16
47 0.14
48 0.17
49 0.17
50 0.15
51 0.15
52 0.13
53 0.12
54 0.11
55 0.11
56 0.06
57 0.06
58 0.07
59 0.07
60 0.06
61 0.08
62 0.11
63 0.13
64 0.13
65 0.18
66 0.19
67 0.2
68 0.22
69 0.2
70 0.19
71 0.21
72 0.21
73 0.18
74 0.19
75 0.23
76 0.22
77 0.22
78 0.21
79 0.18
80 0.17
81 0.17
82 0.15
83 0.19
84 0.23
85 0.25
86 0.27
87 0.29
88 0.3
89 0.31
90 0.32
91 0.25
92 0.22
93 0.2
94 0.19
95 0.19
96 0.18
97 0.16
98 0.13
99 0.12
100 0.11
101 0.09
102 0.07
103 0.05
104 0.05
105 0.05
106 0.06
107 0.08
108 0.07
109 0.08
110 0.1
111 0.15
112 0.23
113 0.24
114 0.25
115 0.24
116 0.27
117 0.27
118 0.26
119 0.2
120 0.13
121 0.12
122 0.11
123 0.11
124 0.07
125 0.06
126 0.04
127 0.04
128 0.04
129 0.03
130 0.02
131 0.01
132 0.01
133 0.01
134 0.02
135 0.03
136 0.05
137 0.06
138 0.07
139 0.08
140 0.16
141 0.25
142 0.33
143 0.35
144 0.36
145 0.36
146 0.36
147 0.37
148 0.31
149 0.22
150 0.13
151 0.1
152 0.09
153 0.09
154 0.07
155 0.07
156 0.06
157 0.07
158 0.06
159 0.06
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.1
168 0.1
169 0.1
170 0.1
171 0.1
172 0.11
173 0.11
174 0.1
175 0.12
176 0.13
177 0.17
178 0.23
179 0.22
180 0.23
181 0.28
182 0.31
183 0.29
184 0.31
185 0.31
186 0.26
187 0.27
188 0.26
189 0.23
190 0.2
191 0.19
192 0.18
193 0.14
194 0.14
195 0.12
196 0.1
197 0.1
198 0.09
199 0.09
200 0.08
201 0.07
202 0.06
203 0.06
204 0.06
205 0.04
206 0.04
207 0.05
208 0.05
209 0.05
210 0.07
211 0.08
212 0.1
213 0.18
214 0.19
215 0.2
216 0.22
217 0.22
218 0.23
219 0.31
220 0.35
221 0.29
222 0.29
223 0.29
224 0.31
225 0.33
226 0.34
227 0.28
228 0.25
229 0.25
230 0.25
231 0.25
232 0.22
233 0.21
234 0.18
235 0.15
236 0.13
237 0.13
238 0.11
239 0.1
240 0.08
241 0.06
242 0.06
243 0.07
244 0.06
245 0.06
246 0.08
247 0.08
248 0.09
249 0.12
250 0.17
251 0.2
252 0.21
253 0.22
254 0.22
255 0.22
256 0.25
257 0.25
258 0.23
259 0.22
260 0.22
261 0.21
262 0.19
263 0.18
264 0.15
265 0.13
266 0.09
267 0.07
268 0.06
269 0.07
270 0.09
271 0.09
272 0.12
273 0.16
274 0.17
275 0.17
276 0.16
277 0.16
278 0.15
279 0.16
280 0.12
281 0.1
282 0.16
283 0.18
284 0.19
285 0.24
286 0.24
287 0.27
288 0.32
289 0.36
290 0.32
291 0.38
292 0.47
293 0.47
294 0.5
295 0.48
296 0.43
297 0.41
298 0.41
299 0.38
300 0.35
301 0.36
302 0.36
303 0.36
304 0.36
305 0.42